PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA19934
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ARR-B
Protein Properties Length: 464aa    MW: 52436.8 Da    PI: 6.9782
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA19934genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like66.25.8e-21268321155
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                k+r++W+pe+  +F++ v +L  ++kAtPk+ile m+v+gLt+ehv+S LQkYRl
  Tp57577_TGAC_v2_mRNA19934 268 KTRVKWSPEMNIKFIRTVVEL-NIDKATPKKILERMNVPGLTREHVASKLQKYRL 321
                                68*******************.9*******************************8 PP

2Response_reg42.73.1e-151142221109
                                EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTT CS
               Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahge 82 
                                vl++d + ++++++++++ k +y +v+++++ ++a ++l  k+  +Dl+l+  +m +md + +l++ +++  ++p+i++ + g+
  Tp57577_TGAC_v2_mRNA19934 114 VLVIDHDINLLNAIEKVCYKFNY-KVKSCSKVSDAFNILLGKKniFDLVLIEAKMNDMDSYGFLQHVTQQI-NIPVIMMCDDGS 195
                                8999*******************.***************666667**********************9988.9*********** PP

                                HHHHHHHHHTTESEEEESS--HHHHHH CS
               Response_reg  83 eedalealkaGakdflsKpfdpeelvk 109
                                 + + +a++ Ga d+  Kp  ++ +++
  Tp57577_TGAC_v2_mRNA19934 196 RSAVMKAIDDGACDYWIKPLTESLIMN 222
                                *******************99887776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23002.8E-23111258No hitNo description
SuperFamilySSF521729.11E-22111243IPR011006CheY-like superfamily
SMARTSM004481.1E-6112224IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011025.585113228IPR001789Signal transduction response regulator, receiver domain
PfamPF000725.9E-11114222IPR001789Signal transduction response regulator, receiver domain
CDDcd001567.77E-11115228No hitNo description
Gene3DG3DSA:1.10.10.601.2E-21266324IPR009057Homeodomain-like
SuperFamilySSF466893.58E-14266324IPR009057Homeodomain-like
TIGRFAMsTIGR015575.9E-18268322IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MVLLREKERI CETSLLQLIP LMKSPTYDLG FLFPSFTKAA EFRARISDEL PIGMTPNSSQ  60
TPSAFTRQVS IAVYLDYPMC SADDDCCSTA STLFLILFAI AMALPQQFST HIRVLVIDHD  120
INLLNAIEKV CYKFNYKVKS CSKVSDAFNI LLGKKNIFDL VLIEAKMNDM DSYGFLQHVT  180
QQINIPVIMM CDDGSRSAVM KAIDDGACDY WIKPLTESLI MNMWQHVARK LWKENKNIEL  240
MSEGVINTSV KQESVEKNND KPESSTNKTR VKWSPEMNIK FIRTVVELNI DKATPKKILE  300
RMNVPGLTRE HVASKLQKYR LELKSGGTKK QKKQNRIAEA TTESKISNES SEFDFQAYDA  360
STLHVVPNNF MPTNFPHQPN NFSHQPNNVP IKFYQTDSEE ETSSPASINQ QQDCNGFGTN  420
SIINPAFIST LNAQFPNAQV RNVYLAQHYP SPNSNDSTST YDL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
138LREKER
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA19934
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2K3L7K00.0A0A2K3L7K0_TRIPR; Two-component response regulator ARR2-like protein
STRINGXP_004515485.12e-69(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1563334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.12e-50response regulator 2