PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA19861
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ARR-B
Protein Properties Length: 561aa    MW: 62610.5 Da    PI: 5.8204
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA19861genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like85.94e-27317371156
                    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                                k +++Wt eLH++Fv+aveqL G+++A+P++il+lmkv+gLt+++v+SHLQkYR++
  Tp57577_TGAC_v2_mRNA19861 317 KMKVDWTAELHKKFVKAVEQL-GIDHAIPSRILDLMKVEGLTRHNVASHLQKYRMH 371
                                5689*****************.********************************96 PP

2Response_reg27.31.9e-103713410109
                                HHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTT.SEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHH CS
               Response_reg  10 vrellrqalekegyeevaeaddgeealellkekd..pDlillDiempg.mdGlellkeireeepklpiivvtahgeeedaleal 90 
                                  + +r+ le  +y +v ++ d  eal  +  +   +++ ++ ++ +    G+++l+   +++ +lp i+ + ++  +++ +++
  Tp57577_TGAC_v2_mRNA19861  37 SPSEIRTKLEAMDY-NVSTFCDVNEALSAISSRPegFHIAIVEVSSSScEGGFKFLE---NAK-DLPTIMTSNNDCLNTTMKCI 115
                                55678899999***.***************777777********9999445566654...444.799999999999******** PP

                                HTTESEEEESS--HHHHHH CS
               Response_reg  91 kaGakdflsKpfdpeelvk 109
                                 +Ga +flsKp ++++l++
  Tp57577_TGAC_v2_mRNA19861 116 ALGAVEFLSKPLSEDKLRN 134
                                ****************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521724.27E-1424142IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.2E-1425171No hitNo description
SMARTSM004480.007826136IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011019.70827140IPR001789Signal transduction response regulator, receiver domain
PfamPF000723.0E-730135IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.27E-741139No hitNo description
PROSITE profilePS5129414.704314373IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.7E-26315373IPR009057Homeodomain-like
SuperFamilySSF466898.96E-18316374IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-24317372IPR006447Myb domain, plants
PfamPF002492.7E-7320369IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
LRKDAKPAMV CTANDLQEWK DFPKGLKVLL LQEDITSPSE IRTKLEAMDY NVSTFCDVNE  60
ALSAISSRPE GFHIAIVEVS SSSCEGGFKF LENAKDLPTI MTSNNDCLNT TMKCIALGAV  120
EFLSKPLSED KLRNIWQHVV HKAFNAGASA VSESLKPVKE SVVSILQLQT ENTQHESRAA  180
VELEKVSQFS DNDHEHYPAP STPQLKQVER LLDDGDCQEQ TNCSTEKESG EHDGESKFVE  240
TTCENLNAES TPQQNKSEVT LVQKEAEEFA DASKCESVVS PRPQNEKVLN NSESNTMSVN  300
KVGVRSHKCE IKANRKKMKV DWTAELHKKF VKAVEQLGID HAIPSRILDL MKVEGLTRHN  360
VASHLQKYRM HKRHILPKQE DRKWLNQRDS TQRSYCIQRP IMPGPPSYYS NHTLPPPPLY  420
PMWGQSGTQM AGMQAWGPSG YPLWQPAETW HWQPFPAMHA DTWGTPVLPP PQPPCYSYSQ  480
NIPAVSNANA VDYMFGMPHS SFDDYPAEDV IDNVVTEAIS KPWLPLPIGL NPPSTDSVLA  540
ELSRQGISNI PPSNNGYIPN *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-16315370358ARR10-B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA19861
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150343e-47AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013457528.10.0two-component response regulator-like APRR2
RefseqXP_024638401.10.0two-component response regulator-like APRR2
SwissprotQ6LA431e-134APRR2_ARATH; Two-component response regulator-like APRR2
TrEMBLA0A2K3P8K00.0A0A2K3P8K0_TRIPR; Two-component response regulator APRR2-like protein (Fragment)
STRINGXP_004508999.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35663465
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18020.61e-133ARR-B family protein
Publications ? help Back to Top
  1. Gong L, et al.
    Transcriptome Profiling of the Potato (Solanum tuberosum L.) Plant under Drought Stress and Water-Stimulus Conditions.
    PLoS ONE, 2015. 10(5): p. e0128041
    [PMID:26010543]