PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA19408
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 327aa    MW: 36640.9 Da    PI: 4.321
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA19408genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.45.5e-3751105660
                     zf-Dof   6 lkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                                 +cprC st+tkfCyynnyslsqPryfCk+CrryWtkGG+lrnvPvGgg+rk ++
  Tp57577_TGAC_v2_mRNA19408  51 PNCPRCASTHTKFCYYNNYSLSQPRYFCKGCRRYWTKGGSLRNVPVGGGCRKTRR 105
                                58**************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2936105IPR003851Zinc finger, Dof-type
PfamPF027012.7E-3151105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.34151105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MFQQRHNNIS STELDQMLHM LTSSNSSIPM PFPTTSMDSN SKWKPNIEIA PNCPRCASTH  60
TKFCYYNNYS LSQPRYFCKG CRRYWTKGGS LRNVPVGGGC RKTRRGKAVR NSQNSDRLSA  120
NGSVDDGDRQ QNQNDGSRDI DMAVVFAKFL NQNPNSTTTN TTHHGDEELE IESEPNNSSS  180
NNVNNLSTPD SVETDNDAVV QSQNYPFDQE LSLSGIEYDQ FEGLLGVDED VVQQDVLWSE  240
SDAMNMMVSS SNNYTWQQPS TMMQMELDYS MSLNEDGGIN HDQLLPLNVN SNSTNVNLIS  300
DQSWMSNSWD SFDLATMEIF SSSSRP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003602157.11e-151Dof domain zinc finger protein
TrEMBLG7J6641e-151G7J664_MEDTR; Dof domain zinc finger protein
STRINGGLYMA04G41830.24e-78(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18173394
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52440.11e-41Dof family protein