PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA19218
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YB
Protein Properties Length: 173aa    MW: 18948 Da    PI: 6.395
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA19218genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB178.27.7e-5628120294
                      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 
                                reqdr+lPian+srimkk+lP+n+ki+kdak+t+qecvsefisf+tseas+kcq+ekrktingddllwa+atlGfedy+eplkv
  Tp57577_TGAC_v2_mRNA19218  28 REQDRYLPIANISRIMKKALPSNGKIAKDAKDTMQECVSEFISFITSEASEKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKV 111
                                89********************************************************************************** PP

                      NF-YB  86 ylkkyrele 94 
                                yl++yre +
  Tp57577_TGAC_v2_mRNA19218 112 YLARYREGD 120
                                ******965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.9E-5323125IPR009072Histone-fold
SuperFamilySSF471134.5E-4030130IPR009072Histone-fold
PfamPF008082.0E-293397IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006152.2E-216179No hitNo description
PROSITE patternPS0068506480IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006152.2E-218098No hitNo description
PRINTSPR006152.2E-2199117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MADAESPAGG SHESGGEQSP HGSSSAAREQ DRYLPIANIS RIMKKALPSN GKIAKDAKDT  60
MQECVSEFIS FITSEASEKC QKEKRKTING DDLLWAMATL GFEDYIEPLK VYLARYREGD  120
SKGSVRNDGS GRRDQVGHPG QNAQFVHQGS LNYIDSQVHP QHLVMPSMQN HE*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B3e-4928118292Transcription factor HapC (Eurofung)
4g92_B3e-4928118292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182820.0JQ918282.1 Medicago truncatula nuclear transcription factor Y subunit B9 (NF-YB9) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003590706.21e-112nuclear transcription factor Y subunit B
SwissprotQ8VYK43e-72NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBLI3TAW71e-114I3TAW7_MEDTR; Nuclear transcription factor Y subunit B9
STRINGGLYMA10G33550.11e-102(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF25453382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37060.32e-73nuclear factor Y, subunit B8