PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA18858
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family HD-ZIP
Protein Properties Length: 279aa    MW: 31090 Da    PI: 8.3781
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA18858genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox54.91.5e-17141195256
                                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                rk+ +++keq   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Tp57577_TGAC_v2_mRNA18858 141 RKKLRLSKEQSAFLEETFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 195
                                778899***********************************************98 PP

2HD-ZIP_I/II126.31.4e-40141231192
                HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekev 84 
                                +kk+rlskeq+++LEe+F+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lk+++++l+een+rL+ke 
  Tp57577_TGAC_v2_mRNA18858 141 RKKLRLSKEQSAFLEETFKEHTTLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKKCCETLTEENRRLQKEL 224
                                69********************************************************************************** PP

                HD-ZIP_I/II  85 eeLreelk 92 
                                +eLr +lk
  Tp57577_TGAC_v2_mRNA18858 225 QELR-ALK 231
                                ***9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-17124195IPR009057Homeodomain-like
SuperFamilySSF466891.34E-18130198IPR009057Homeodomain-like
PROSITE profilePS5007117.135137197IPR001356Homeobox domain
SMARTSM003893.2E-15139201IPR001356Homeobox domain
PfamPF000464.2E-15141195IPR001356Homeobox domain
CDDcd000861.68E-15141198No hitNo description
PROSITE patternPS000270172195IPR017970Homeobox, conserved site
SMARTSM003409.9E-26197240IPR003106Leucine zipper, homeobox-associated
PfamPF021831.9E-10197231IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MELALSLGDT PKPFSLFENP NKGFSIVLEQ AQKSLDEKRG SSDPPIQLNL LPSTPVHPSP  60
HQIPWLNHAL GVETARVTNA NRFRLASVED TTDEGAAVSS PNSAASSFRM DFSIMNGNCD  120
ARNNSREGGV DSDDDENGST RKKLRLSKEQ SAFLEETFKE HTTLNPKQKL ALAKQLNLRP  180
RQVEVWFQNR RARTKLKQTE VDCEYLKKCC ETLTEENRRL QKELQELRAL KTSQPFYMQL  240
PATTLTMCPS CERVATNTTG EAATKNTTSI IAGGRHQK*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1139145TRKKLRL
2189197RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA18858
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1430661e-75BT143066.1 Medicago truncatula clone JCVI-FLMt-13B2 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003625279.11e-150homeobox-leucine zipper protein HOX11
SwissprotP466659e-87HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2Z6N3R00.0A0A2Z6N3R0_TRISU; Uncharacterized protein
STRINGAES814971e-149(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.13e-70homeobox from Arabidopsis thaliana