PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA18620
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 219aa    MW: 23998 Da    PI: 8.1361
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA18620genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260143.85e-4531129199
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrrkC ++C++apyfp e+p+kfanvhk+FGasnv+k+l++l +++reda++sl+yeAear+rdPvyG+vg i+ lq
  Tp57577_TGAC_v2_mRNA18620  31 PCAACKFLRRKCMPGCIFAPYFPPEEPQKFANVHKIFGASNVTKILNELLPHQREDAVNSLAYEAEARVRDPVYGCVGAISFLQ 114
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallke 99 
                                +q+++l++el+++++
  Tp57577_TGAC_v2_mRNA18620 115 RQVQRLQKELDSANA 129
                                **********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.78630131IPR004883Lateral organ boundaries, LOB
PfamPF031956.3E-4431128IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010199Biological Processorgan boundary specification between lateral organs and the meristem
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MRSIDKFYDT IYCFFFSAGK TMASSSSYNS PCAACKFLRR KCMPGCIFAP YFPPEEPQKF  60
ANVHKIFGAS NVTKILNELL PHQREDAVNS LAYEAEARVR DPVYGCVGAI SFLQRQVQRL  120
QKELDSANAD LLRFAYNDSS LPPLPPLVVP ASFHHHHHHQ QLTPQRQLQF GSRFGNGGNI  180
DGSGFYSFPY AIPWNDTSSD DLSGGVGGRG GGVGGGNL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00581DAPTransfer from AT5G63090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6531631e-152JQ653163.1 Pisum sativum elongated petiolule 1-like protein (APU) gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003601210.22e-97lateral organ boundaries (LOB) domain protein
SwissprotQ9FML47e-73LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLI6QB376e-98I6QB37_PEA; Elongated petiolule 1-like protein
STRINGGLYMA05G02530.23e-96(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G63090.43e-75LBD family protein