PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA1833
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 177aa    MW: 19932.9 Da    PI: 6.6419
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA1833genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260136.11.3e-42181171100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+
  Tp57577_TGAC_v2_mRNA1833  18 PCAACKILRRRCVEKCVLAPYFPPTDPLKFTIAHRVFGASNIIKFLQELPEPQRADAVSSMVYEANARIRDPVYGCAGAICQLQK 102
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               q+++l+++la++++e
  Tp57577_TGAC_v2_mRNA1833 103 QVSELQTQLAKAQAE 117
                               ***********9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.89817118IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-4218115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 177 aa     Download sequence    Send to blast
MFYSSRYHTP DQNRDISPCA ACKILRRRCV EKCVLAPYFP PTDPLKFTIA HRVFGASNII  60
KFLQELPEPQ RADAVSSMVY EANARIRDPV YGCAGAICQL QKQVSELQTQ LAKAQAEIVN  120
MHCQQANLVA LICMEMSNQS SPQDHNMIIN QPQPHVDMSC FLEDNNFGSA WEPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1528181e-145AC152818.17 Medicago truncatula clone mth2-85g12, complete sequence.
GenBankAC1444841e-145AC144484.5 Medicago truncatula clone mth2-30o16, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003591977.11e-111lateral organ boundaries (LOB) domain protein
SwissprotQ9LQR03e-72LBD1_ARATH; LOB domain-containing protein 1
TrEMBLG7I9N11e-111G7I9N1_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA20G31780.18e-98(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.12e-73LOB domain-containing protein 1