PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA18266
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 204aa    MW: 22819.8 Da    PI: 4.7934
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA18266genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.64.4e-43371361100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrr+Ca++C+lapyfp +qp+kf  +h++FGasn++k+l++lpe+er da++s+vyeA ar+rdPvyG++g+i +lq
  Tp57577_TGAC_v2_mRNA18266  37 PCAACKILRRRCAEKCMLAPYFPPTQPSKFTTAHRVFGASNIIKILQELPESERADAVNSMVYEASARIRDPVYGCAGTICHLQ 120
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                +q+++l+a+la+ ++e
  Tp57577_TGAC_v2_mRNA18266 121 KQVNELQAQLAKSQAE 136
                                ***********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.32336137IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-4337134IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MENVTNKITN TSISSPLFFN SSTSSQPTLV PQVVMSPCAA CKILRRRCAE KCMLAPYFPP  60
TQPSKFTTAH RVFGASNIIK ILQELPESER ADAVNSMVYE ASARIRDPVY GCAGTICHLQ  120
KQVNELQAQL AKSQAELINM QLQQSNLLSL IYMEMNETPN ESSPQESVDN FISSPNYSSD  180
YQNNLNFFEE NTNPNLLWEP LWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1923521e-126AC192352.2 Medicago truncatula chromosome 2 BAC clone mte1-82k18, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003597159.11e-120lateral organ boundaries (LOB) domain protein
SwissprotQ9SK086e-80LBD11_ARATH; LOB domain-containing protein 11
TrEMBLG7IKN31e-120G7IKN3_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA13G40370.21e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.12e-70LOB domain-containing protein 11