PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA18189
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ARR-B
Protein Properties Length: 371aa    MW: 41615.6 Da    PI: 6.176
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA18189genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like52.79.4e-17179230255
                    G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                 r+ Wt +LH++F++av+   G++ A Pkti elm+v+gL  e v+  L kYR 
  Tp57577_TGAC_v2_mRNA18189 179 RRRTWTDDLHRKFLDAVQTA-GIN-APPKTIFELMDVEGLKKESVRNYLKKYRQ 230
                                699****************9.776.****************************6 PP

2Response_reg42.72.9e-15231311109
                                EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTT CS
               Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahge 82 
                                vl+vd + + r ++ + l + gy eva+a+ ++eal ++ ek+  ++l+l+  ++p+m+ +el+ ++++++  +p  ++t++++
  Tp57577_TGAC_v2_mRNA18189  23 VLVVDANSACRAVISKSLLSLGY-EVATATLASEALSIIGEKKneINLVLVEAQLPDMEIYELVAKMKSSN--IPSFIMTSYDD 103
                                89*********************.***************776667***********************977..89889997777 PP

                                .HHHHHHHHHTTESEEEESS--HHHHHH CS
               Response_reg  83 .eedalealkaGakdflsKpfdpeelvk 109
                                    +++al+ Gak  + Kp+ +++l +
  Tp57577_TGAC_v2_mRNA18189 104 dILSITQALHIGAKWSFRKPVRISDLQQ 131
                                588999****************999976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.50.23002.8E-2019134No hitNo description
SuperFamilySSF521724.7E-1920138IPR011006CheY-like superfamily
SMARTSM004481.2E-521133IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011026.52422137IPR001789Signal transduction response regulator, receiver domain
PfamPF000721.4E-1123131IPR001789Signal transduction response regulator, receiver domain
CDDcd001567.91E-1324136No hitNo description
SuperFamilySSF466896.54E-9176232IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-14177231IPR009057Homeodomain-like
TIGRFAMsTIGR015576.3E-13179230IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MEFNMPQLAV PRIYTGPVAG VKVLVVDANS ACRAVISKSL LSLGYEVATA TLASEALSII  60
GEKKNEINLV LVEAQLPDME IYELVAKMKS SNIPSFIMTS YDDDILSITQ ALHIGAKWSF  120
RKPVRISDLQ QLWRFAVWNR FERAFCEEVF YYWWPEVVTN GKAQESFDNK DTIVLLKTRR  180
RTWTDDLHRK FLDAVQTAGI NAPPKTIFEL MDVEGLKKES VRNYLKKYRQ SMNLHASPMG  240
QHVNGDVSLN KKSRGKRSLS LGSQGVTDNP AFNQKDLSNF VPASEIISQV VNTADGKVSN  300
AGQQLNFSTL LAFNMSDQFF PALPIALLPI EKNEKIDEVY NAKESQMFTD EDLKMWLSTI  360
SDNVTQDAVA *
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA18189
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004510876.11e-147two-component response regulator ARR14 isoform X2
TrEMBLA0A2K3NX210.0A0A2K3NX21_TRIPR; Two-component response regulator ARR2-like protein
STRINGXP_004510871.11e-143(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF1436288
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67710.15e-24response regulator 11