PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA18019
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family HD-ZIP
Protein Properties Length: 792aa    MW: 86700.4 Da    PI: 6.0824
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA18019genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox65.57.5e-2195150156
                                TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                   Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                +++ +++t++q++eLe++F+++++p++++r +L+k+lgL+ +qVk+WFqNrR+++k
  Tp57577_TGAC_v2_mRNA18019  95 KKRYHRHTPNQIQELESFFKECPHPDEKQRLDLSKRLGLENKQVKFWFQNRRTQMK 150
                                678899***********************************************999 PP

2START167.11.2e-523035252205
                                HHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGG...CT- CS
                      START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddke...qWd 73 
                                la++a++el+k+a+ + p W k      +++n +e+ ++f++  +     + +ea r++g+v+ ++  l+e+l+d ++    ++
  Tp57577_TGAC_v2_mRNA18019 303 LALAAMDELLKMAQTDNPIWIKGLdgerDILNHEEYARSFSSCIGpkpagFVSEATRETGIVIINSLALMETLMDANRyadMFQ 386
                                6899*******************99999************988889*******************************8888888 PP

                                TT-SEEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSE CS
                      START  74 etlakaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpS 150
                                 ++a+   l+v+s g      ga++lm ae q+lsplvp R + ++R+++q+ +g+w++vdvSv+   +  + ++++ +++lpS
  Tp57577_TGAC_v2_mRNA18019 387 SMIARSVNLDVLSGGiggtrnGAIHLMHAEVQLLSPLVPvRQVKILRFCKQHAEGVWAVVDVSVEIGHDAANAQPFISCRRLPS 470
                                8888999**********************************************************99999999*********** PP

                                EEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                      START 151 giliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                                g+++++++ng+skvtw+eh++++++++h+l+r+l+ sg  +ga +w atlqrqce
  Tp57577_TGAC_v2_mRNA18019 471 GCIVQDMPNGYSKVTWIEHWEYDESVVHNLYRPLIISGSGFGAHRWIATLQRQCE 525
                                ******************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.55E-2081152IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-2282146IPR009057Homeodomain-like
PROSITE profilePS5007117.96192152IPR001356Homeobox domain
SMARTSM003894.3E-1993156IPR001356Homeobox domain
CDDcd000868.04E-1994152No hitNo description
PfamPF000461.7E-1895150IPR001356Homeobox domain
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
PROSITE profilePS5084838.668293529IPR002913START domain
SuperFamilySSF559619.48E-29295526No hitNo description
CDDcd088751.56E-110297525No hitNo description
SMARTSM002341.7E-34302526IPR002913START domain
PfamPF018522.5E-44303525IPR002913START domain
Gene3DG3DSA:3.30.530.209.5E-4358496IPR023393START-like domain
SuperFamilySSF559612.61E-22553785No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 792 aa     Download sequence    Send to blast
MGFESVNSSC KVARLVTDIS IPFSSSMQNS STFFSTQKKM EGQSEIGLTS ESLDTSMIGR  60
MREDEYESRS GSDNFDLEGI YGDDQDGDDG QRKRKKRYHR HTPNQIQELE SFFKECPHPD  120
EKQRLDLSKR LGLENKQVKF WFQNRRTQMK TQLERHENIM LRQENDKLRG ENSMMKEAMV  180
NPICNNCGGP AIPGQILFEE HQIRIENARL KDELNRICAL TNKFLGKPIS SLANPMALPT  240
SNSGLELGIG RNGFGGGSSS HGTSLPMGLD LGDGPAMHGI RSPMGLMGNS NDVQLERSVL  300
IDLALAAMDE LLKMAQTDNP IWIKGLDGER DILNHEEYAR SFSSCIGPKP AGFVSEATRE  360
TGIVIINSLA LMETLMDANR YADMFQSMIA RSVNLDVLSG GIGGTRNGAI HLMHAEVQLL  420
SPLVPVRQVK ILRFCKQHAE GVWAVVDVSV EIGHDAANAQ PFISCRRLPS GCIVQDMPNG  480
YSKVTWIEHW EYDESVVHNL YRPLIISGSG FGAHRWIATL QRQCEGLAIL MSSSISSDDH  540
TALSQAGRRS MLKLAQRMTN NFCSGVCASS ARKWDSLQMG TLSDDMRVMT RKNVDDPGEP  600
PGIVLSAATS VWMPVSRQRL FDFLRDERLR SEWDILSNGG PMQEMVHIAK GQGQGNCVSL  660
LRANAVNAND SSMLILQETW MDTSCSVVVY APVDGQSLNV VMSGGDSAYV ALLPSGFAIV  720
PDGNNSSGYG SSNGTLQKGG GSDDGGSLLT VGFQILVNSL PSAKLTMESV DTVNNLISCT  780
IQKIKAALRV A*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19195RKRKK
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA18019
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1494940.0AC149494.4 Medicago truncatula clone mth2-116m7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024625328.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A2K3P2Z10.0A0A2K3P2Z1_TRIPR; Homeobox-leucine zipper protein anthocyaninless 2-like
STRINGXP_004496593.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.10.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]