PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA17840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Trihelix
Protein Properties Length: 293aa    MW: 34928.2 Da    PI: 8.0959
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA17840genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix88.57.7e-2840121186
                   trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdq 84 
                                +W++qe+++ i++r e+e+++ ++k++k+lWe vs+kmrerg++rsp+qCk+kw+nl +ryk  ++++ ++     ++cp+f++
  Tp57577_TGAC_v2_mRNA17840  40 QWSQQETREFIAIRAELERDFTASKRNKTLWEVVSSKMRERGYRRSPEQCKCKWKNLVNRYKGKETSDPEH----GRQCPFFEE 119
                                7****************************************************************999986....678****** PP

                   trihelix  85 le 86 
                                l+
  Tp57577_TGAC_v2_mRNA17840 120 LH 121
                                98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007176.9E-43799IPR001005SANT/Myb domain
CDDcd122039.02E-2640104No hitNo description
PfamPF138377.1E-2440122No hitNo description
PROSITE profilePS500907.74197IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 293 aa     Download sequence    Send to blast
MYGGGGVGDD DLAARLGMIP PSLLIPTTSV RDERLPTQLQ WSQQETREFI AIRAELERDF  60
TASKRNKTLW EVVSSKMRER GYRRSPEQCK CKWKNLVNRY KGKETSDPEH GRQCPFFEEL  120
HAVFTERAHN MQRLLLESET RSAQTKKGVK RVRSGDRSSE EISEDDEDVE DDSEEERPAR  180
SNTRKRKAGK IATEKSSRVN NSNIQEMLKE FFQNQLRMEM QWREMMERRA HERQLFEQEW  240
RQSMEKLERE RLMIEQEWRE REEHRRLREE SRAERRDALL TTLLNKLIHE SN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A1e-1441111777DNA binding protein GT-1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU9141350.0CU914135.3 Medicago truncatula chromosome 5 clone mth4-3n15, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014521444.11e-167PREDICTED: trihelix transcription factor GT-3b-like
TrEMBLA0A0L9URU21e-164A0A0L9URU2_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T3G01e-164A0A0S3T3G0_PHAAN; Uncharacterized protein
STRINGGLYMA01G35370.21e-162(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.14e-36Trihelix family protein