PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA17378
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 171aa    MW: 19616.2 Da    PI: 6.4955
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA17378genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260123.88.9e-39181181101
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk +rr+C++dC+++pyfp ++p++fa+vhk++G snv k+l++lpe  re+a+++l+ eA+ r++dPvyG+vg+++kl 
  Tp57577_TGAC_v2_mRNA17378  18 RCAACKSQRRRCPSDCIFSPYFPPNDPQRFAYVHKIYGGSNVGKMLQQLPEYLREQAVNTLYLEAQSRIQDPVYGCVGIVSKLY 101
                                6*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkeel 101
                                qq++ ++aela++++++
  Tp57577_TGAC_v2_mRNA17378 102 QQIHDTEAELAKIQTQI 118
                                ************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.27317118IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-3818115IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
LDFFPLYTKD SEIMIYGRCA ACKSQRRRCP SDCIFSPYFP PNDPQRFAYV HKIYGGSNVG  60
KMLQQLPEYL REQAVNTLYL EAQSRIQDPV YGCVGIVSKL YQQIHDTEAE LAKIQTQIAC  120
HKLQNQQFEV ESNFNVLSTV DAESKLNFLP TQSNSMEQIQ WPNHVPNLFN *
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU1798942e-73CU179894.1 Medicago truncatula chromosome 5 clone mth4-21m22, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004491406.12e-94PREDICTED: LOB domain-containing protein 23-like
SwissprotP594677e-47LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594687e-47LBD24_ARATH; LOB domain-containing protein 24
TrEMBLG7K3J32e-88G7K3J3_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA14G02440.23e-69(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.14e-48LOB domain-containing protein 24