PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA17191
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family ZF-HD
Protein Properties Length: 461aa    MW: 51576.5 Da    PI: 8.2654
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA17191genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer92.73.3e-29281335459
                ZF-HD_dimer   4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                                ++YkeClkNhAas+Gg+a+DGCgEfm+s ge+ t +alkC  C+CHRnFHR+e e+
  Tp57577_TGAC_v2_mRNA17191 281 AKYKECLKNHAASIGGNATDGCGEFMSS-GENDTLEALKCCVCNCHRNFHRKEIES 335
                                68*************************9.8888*******************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:3.40.830.101.4E-965260IPR004183Extradiol ring-cleavage dioxygenase, class III enzyme, subunit B
SuperFamilySSF532133.53E-916260IPR004183Extradiol ring-cleavage dioxygenase, class III enzyme, subunit B
PfamPF029009.3E-566260IPR004183Extradiol ring-cleavage dioxygenase, class III enzyme, subunit B
CDDcd073634.96E-1296260No hitNo description
PfamPF047704.1E-26281333IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015664.3E-28282333IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257742.0E-20282343IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.538283332IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.607.7E-24383453IPR009057Homeodomain-like
SuperFamilySSF466891.49E-13388453IPR009057Homeodomain-like
TIGRFAMsTIGR015655.5E-23392449IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006725Biological Processcellular aromatic compound metabolic process
GO:0003677Molecular FunctionDNA binding
GO:0008198Molecular Functionferrous iron binding
GO:0016491Molecular Functionoxidoreductase activity
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MALKETFYIS HGSPTLAIDE TIPAWKFLTS WKEVFPHRPS AILVISGHWD TSVPTVNVVN  60
HNETIHDFGG FPRSMYKLKY PAPGAPKLAK RVKELVEASG LSRVDEDKKR GLDHGTWVPL  120
MLMYPEADIP VCQLSVSSNK DGTYHYNLGK ALAPLKDEGV LIIGSGSATH NLRAMAPRGS  180
PTPAWASAFD SWLKESVVEG RYDDINHYEE KAPYAKVAHP WPDHFYPLHV AMGAAGENSK  240
AKVVHESWDG GAFSYASFGF TAASYNSFIE ASKDMEKKLV AKYKECLKNH AASIGGNATD  300
GCGEFMSSGE NDTLEALKCC VCNCHRNFHR KEIESDSQHY AISLIPDHNI NAPFLAHLSP  360
NNKSGSTSPS EQSYYEKDCI KEDENRTEKM IKKRSRTKFS KEQKEKMLCF AEKAEWKIQK  420
LEESVVHKFC LDIGIKRRIL KVWMHNNKNT FAKRNISSTS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2pw6_A7e-47725718267Uncharacterized protein ygiD
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1398520.0AC139852.18 Medicago truncatula clone mth2-8n13, complete sequence.
GenBankBT1376270.0BT137627.1 Medicago truncatula clone JCVI-FLMt-1P8 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013468810.10.04,5-DOPA dioxygenase extradiol-like protein
SwissprotQ70FG71e-123DODA_BETVU; 4,5-DOPA dioxygenase extradiol
TrEMBLA0A072VM250.0A0A072VM25_MEDTR; 4,5-DOPA dioxygenase extradiol-like protein
STRINGGLYMA09G28490.11e-159(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14440.29e-55homeobox protein 31