PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA16803
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family GATA
Protein Properties Length: 292aa    MW: 32427 Da    PI: 5.032
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA16803genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.83.5e-19214247134
                       GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                                Cs+C++ kTp+WR gp g+ktLCnaCG+++++ +
  Tp57577_TGAC_v2_mRNA16803 214 CSHCQVQKTPQWRAGPLGPKTLCNACGVRFKSGR 247
                                *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169929.0E-7316290IPR016679Transcription factor, GATA, plant
SMARTSM004011.3E-15208258IPR000679Zinc finger, GATA-type
SuperFamilySSF577161.81E-14211271No hitNo description
Gene3DG3DSA:3.30.50.101.3E-14212245IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.055212244IPR000679Zinc finger, GATA-type
CDDcd002024.35E-15213270No hitNo description
PfamPF003206.7E-17214247IPR000679Zinc finger, GATA-type
PROSITE patternPS003440214239IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MEVVVAKALK PSLRTESIFQ QTICEEILCL NANNVVVGED FSVDDYLLDF SNGEFQHGSV  60
GKEIDDYEEE EEEEHEKNST TSVCSQDRTE DDGNSNSTTF SGAGDGESDS IFAGGLSVPA  120
DDVADLEWVS QFVDDSVPEL SLLYPVQARV EPEPRPGPTK ATSQLSLIRK KPRTNKPRRP  180
NCNMWAFNPV LCSAKKQRKK PEAQTGGAQF QRRCSHCQVQ KTPQWRAGPL GPKTLCNACG  240
VRFKSGRLFP EYRPASSPTF SGDIHSNSHR KVLEMRRRKE TDEPETGLDR N*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003607047.10.0GATA type zinc finger transcription factor family protein
RefseqXP_013456438.10.0GATA type zinc finger transcription factor family protein
TrEMBLG7JJU10.0G7JJU1_MEDTR; GATA type zinc finger transcription factor family protein
STRINGGLYMA12G04180.21e-122(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.25e-48GATA transcription factor 5