PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA16534
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family HD-ZIP
Protein Properties Length: 311aa    MW: 35360.1 Da    PI: 6.6635
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA16534genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox57.42.5e-18170224256
                                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                rk+ +++k+q   Lee F+++ +++ +++  LAk+l+L+ rqV vWFqNrRa+ k
  Tp57577_TGAC_v2_mRNA16534 170 RKKLRLSKDQSAFLEESFKEHTTLNPKQKLALAKQLNLSPRQVEVWFQNRRARTK 224
                                778899***********************************************98 PP

2HD-ZIP_I/II126.61.1e-40170259191
                HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekev 84 
                                +kk+rlsk+q+++LEesF+e+++L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke 
  Tp57577_TGAC_v2_mRNA16534 170 RKKLRLSKDQSAFLEESFKEHTTLNPKQKLALAKQLNLSPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKEL 253
                                69********************************************************************************** PP

                HD-ZIP_I/II  85 eeLreel 91 
                                +eLr +l
  Tp57577_TGAC_v2_mRNA16534 254 QELR-AL 259
                                ***9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.9E-450130IPR006712HD-ZIP protein, N-terminal
SuperFamilySSF466892.21E-18163227IPR009057Homeodomain-like
PROSITE profilePS5007117.329166226IPR001356Homeobox domain
SMARTSM003895.1E-17168230IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.5E-17170224IPR009057Homeodomain-like
CDDcd000864.69E-16170227No hitNo description
PfamPF000468.2E-16170224IPR001356Homeobox domain
PROSITE patternPS000270201224IPR017970Homeobox, conserved site
SMARTSM003403.8E-25226269IPR003106Leucine zipper, homeobox-associated
PfamPF021836.1E-11226260IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MELALSLGDT PKLPFSFLDK PTKDPLPNLL LTQQGKNLEL EESGSLDPPI QLDLLPFSPV  60
LRSHHSSSHL PIPWLTQPCN FLFIIKDYMI TMISQLYCGP VRELDVNRFP AMTEEADDGA  120
SLSSPSSSVS PFQMDFSMMN NNAEYGGRNK RENEGEAERV SDDDENGSTR KKLRLSKDQS  180
AFLEESFKEH TTLNPKQKLA LAKQLNLSPR QVEVWFQNRR ARTKLKQTEV DCEYLKRCCE  240
TLTEENRRLQ KELQELRALK TNQPFYMQLP ATTLTMCPSC ERVATNPCNN QTNNKARVQQ  300
QKAQAHQIPS *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1168174TRKKLRL
2218226RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA16534
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013467691.11e-167homeobox-leucine zipper protein HOX11
SwissprotP466652e-85HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A2Z6NJL40.0A0A2Z6NJL4_TRISU; Uncharacterized protein
STRINGXP_004497887.11e-158(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23353382
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.19e-71homeobox from Arabidopsis thaliana