PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA16456
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 260aa    MW: 28666.8 Da    PI: 8.5729
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA16456genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.41.8e-392079261
                     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                               ++++++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknkk+
  Tp57577_TGAC_v2_mRNA16456 20 PQEQINCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKKV 79
                               6899*****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-271578IPR003851Zinc finger, Dof-type
PfamPF027011.8E-332278IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.9662478IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102662IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009639Biological Processresponse to red or far red light
GO:0009845Biological Processseed germination
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MEGLAPNSCP RQGLEKKARP QEQINCPRCN STNTKFCYYN NYSLTQPRYF CKTCRRYWTE  60
GGSLRNVPVG GGSRKNKKVI NPSSTKIPDL NPPTLVQVSP LSNSQNPKMQ GGQDLNLAFP  120
SMENYHQHHH GMSSYVEMHN NNESSSSALD LLRSSMASRG LNPYANNNNT LMTNSNTIFP  180
SGFPMQEVKP SLGFSIDGIN GNRSYDDHVH VQEGGGGRLL FPFGDVNKQL STSGVEVEHN  240
KEQGNSTGFW NGMIGEGSW*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2209413e-55KF220941.1 Glycine soja cultivar IT178480 clone 2f2r Dof-type zinc finger DNA-binding family protein (Glyma16g02550) gene, partial cds.
GenBankKF2209403e-55KF220940.1 Glycine soja cultivar IT162825 clone 2f2r Dof-type zinc finger DNA-binding family protein (Glyma16g02550) gene, partial cds.
GenBankKF2209343e-55KF220934.1 Glycine max cultivar Ilpumgeomjeong clone 2f2r Dof-type zinc finger DNA-binding family protein (Glyma16g02550) gene, partial cds.
GenBankKF2209323e-55KF220932.1 Glycine max cultivar Pureun clone 2f2r Dof-type zinc finger DNA-binding family protein (Glyma16g02550) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013444589.11e-154Dof-type zinc finger DNA-binding family protein
SwissprotQ433852e-62DOF37_ARATH; Dof zinc finger protein DOF3.7
TrEMBLA0A072TM781e-154A0A072TM78_MEDTR; Dof-type zinc finger DNA-binding family protein
STRINGGLYMA07G05950.11e-119(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61850.42e-57Dof family protein