PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA16200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family CPP
Protein Properties Length: 886aa    MW: 96554.2 Da    PI: 6.1701
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA16200genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR47.73.1e-15515551440
                        TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                k+CnCkkskClk+YC+Cf ag +C+e+C Ce+C N+ 
  Tp57577_TGAC_v2_mRNA16200 515 KSCNCKKSKCLKLYCDCFGAGLFCGEDCACESCGNRV 551
                                79*********************************86 PP

2TCR49.31e-15600639140
                        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                                ++k+gCnCkkskC kkYCeCf+a++ Cs  C+C++C+N  
  Tp57577_TGAC_v2_mRNA16200 600 RHKRGCNCKKSKCTKKYCECFQANVGCSTGCRCDGCMNAF 639
                                589***********************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.0E-11512553IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163432.825513640IPR005172CRC domain
PfamPF036389.9E-12515550IPR005172CRC domain
SMARTSM011144.8E-15600641IPR033467Tesmin/TSO1-like CXC domain
PfamPF036384.5E-11602638IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 886 aa     Download sequence    Send to blast
MDSPEPSKIN NNNNTSSSYS SLSTLNAAAE SPQVQESPFL RFVNTLSPIK PVKASHATHG  60
FLGLNSPPLV FKSPRISDHH REKQYLERPQ GSNLSSGEIS QSDIGDNSLG EARGDLKKLT  120
SQQSLPEGFI TDAQKEFGVK NDANNESCSP PQSVEEYLAD PGEDQLFPVN PETEQSTDAV  180
GSSLTETERV ILKFDRSDGP SNRAEELLPL LEESNMVHQE RQAYVENNSI VEGEKNGAEL  240
VSQEHVNLGS SSGADAFDKQ YCNDSLPQFL LIDLQNFKLQ CVGNDQRHQS DCKPQLMPDP  300
IQDVKEFENS NEMVSTSQVN SENIPQDGSE ASLKYHGFRR RCLQFDEAAS IVLGSNKFHV  360
KMNATSSNVK IVPVAGSKPP GIGLHLNSIV NAMPPSRASI SGVRLSDGLQ GIQSKPSISL  420
HKVESVTRSS VPSNMDGQSF IDTRNESHET DASVVADSFI SESPILKESI DLYPANTNDK  480
KRVSPTEVEN TEESNHRSTS RKKKKTSADD GSGPKSCNCK KSKCLKLYCD CFGAGLFCGE  540
DCACESCGNR VEFQETVVET KHHIESRNPQ AFAPKIVLCA ADVPPNNMED VNMTTPASAR  600
HKRGCNCKKS KCTKKYCECF QANVGCSTGC RCDGCMNAFG KREDFVAMEH ALSKERESSI  660
VEEGFDDTLH NKQKMVTVRT GLFRPVNHLS PVTPLLECSD QGKQAAKSRV PSASWTKSSK  720
KSRSSLAHSE SNNSQKNAPT GPSSKDNEWL DLPPYQLSNR CGIRQLSGGS LRWRGSSPIT  780
PNDSKDDESD DKLFDILEDE TPDVLKEAST PIKSVKANSP IQKRVSPPQN HLLRIGSSSS  840
VGGLKSGRKF ILQSVPSFPP LTPCADSKAI RTANEDSGNS TDKVT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1551563712120Protein lin-54 homolog
5fd3_B3e-1551563712120Protein lin-54 homolog
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA16200
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ4555171e-107DQ455517.1 Medicago truncatula cDNA-AFLP fragment BT42M33_467 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024631077.10.0CRC domain-containing protein TSO1 isoform X3
TrEMBLA0A2K3PER60.0A0A2K3PER6_TRIPR; Cysteine-rich polycomb-like protein
STRINGAES589760.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85652841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.11e-37Tesmin/TSO1-like CXC domain-containing protein