PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA15924
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 114aa    MW: 12513 Da    PI: 4.2543
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA15924genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26053.75.9e-1725349100
                     DUF260  49 lpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                                +pe++r da++slvyeA++r+rdPvyG++g i++lqqq+++l  el++++ee
  Tp57577_TGAC_v2_mRNA15924   2 VPENQRADAANSLVYEANVRLRDPVYGCMGAISSLQQQIQSLLGELNVIREE 53 
                                7899******************************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089111.742154IPR004883Lateral organ boundaries, LOB
PfamPF031956.5E-15251IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 114 aa     Download sequence    Send to blast
EVPENQRADA ANSLVYEANV RLRDPVYGCM GAISSLQQQI QSLLGELNVI REEIHKYKLM  60
EANMIPSSED LSIASSTLPS TTSLPMLPSS IYTQQTNPTN YSSISSDHIS YFD*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCR9387101e-131CR938710.1 Medicago truncatula chromosome 5 clone mth2-170k9, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003616758.13e-69LOB domain protein
SwissprotQ9AT612e-25LBD13_ARATH; LOB domain-containing protein 13
TrEMBLG7KH283e-69G7KH28_MEDTR; LOB domain protein
STRINGGLYMA06G15050.19e-40(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF22983486
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-21LOB domain-containing protein 15