PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA15088
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Dof
Protein Properties Length: 453aa    MW: 50300.4 Da    PI: 6.9738
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA15088genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof119.99.5e-38119178261
                     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                                ++k l+cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GGa+rnvP+G+g+r+nk+s
  Tp57577_TGAC_v2_mRNA15088 119 PDKVLPCPRCNSLETKFCYFNNYNVNQPRHFCKKCQRYWTAGGAIRNVPIGAGKRRNKHS 178
                                78999*****************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-28116176IPR003851Zinc finger, Dof-type
PfamPF027012.6E-31120177IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.341123177IPR003851Zinc finger, Dof-type
PROSITE patternPS013610125161IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 453 aa     Download sequence    Send to blast
MFQDPSIKLF GSDIQIHIPI NSTDSHSQIY SLPQQPIIIM FGTQLQNGIE ESSNADVGVP  60
LNEVSSKQAN AFPQEDANAF PNMYETGTSK PVTKAVHRNN EHRTAKRDTD NQEKAFKKPD  120
KVLPCPRCNS LETKFCYFNN YNVNQPRHFC KKCQRYWTAG GAIRNVPIGA GKRRNKHSPL  180
QNCEVPVTLD VVPVIHTDSN PASLNEEVPL SESLEVLNLK GHRKIEIDLS TIKEDIDEPS  240
RSSVKAAESG KMEYSENGIE HVSLTTQYNG LIPLHALHYY SAPPWQWNPC WNPTAFKPDN  300
ITSTPANMMA VEIPMTPSSY WSCMANWVGQ MEEFNGIPSP SSSVSSGTCS GNRSPTLGKH  360
CRDGSTQEED TMKPNIWVPK TIRINDPEEA AKSSIWSTLA TKSKQNKPVM KGSVFKSFEP  420
KSNASSHDLD DNQILRANPA AFSRSGSFQE SM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003628145.10.0DOF-type zinc finger DNA-binding family protein
TrEMBLG8A1Q80.0G8A1Q8_MEDTR; DOF-type zinc finger DNA-binding family protein
STRINGGLYMA08G24591.11e-163(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35023165
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.24e-58cycling DOF factor 2