PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA1498
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family HD-ZIP
Protein Properties Length: 688aa    MW: 77363.6 Da    PI: 6.1744
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA1498genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.53.7e-21119174156
                               TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                  Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                               +++ +++t++q++eLe+lF+++++p++++r eL+k+l L++rqVk+WFqNrR+++k
  Tp57577_TGAC_v2_mRNA1498 119 KKRYHRHTPQQIQELEALFKECPHPDEKQRLELSKRLCLETRQVKFWFQNRRTQMK 174
                               688999***********************************************999 PP

2START203.68e-643225461206
                               HHHHHHHHHHHHHHHHC-TT-EEEE....EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT- CS
                     START   1 elaeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetl 76 
                               ela++a++elvk+a+ +ep+W +s     e++n +e++++f++  +     + +ea+r++g v+ ++  lve+l+d++ +W e++
  Tp57577_TGAC_v2_mRNA1498 322 ELALTAMDELVKMAQTSEPLWIRSIeggrEILNHEEYMRTFTPCIGlkpngFVSEASRETGTVIINSLALVETLMDSN-RWIEMF 405
                               5899**************************************99999*******************************.****** PP

                               S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSE CS
                     START  77 a....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpS 150
                               +    + +t evi +g      galqlm+ael +lsplvp R++ f+R+++q+ +g+w++vdvS+ds ++ +   s++ +++lpS
  Tp57577_TGAC_v2_mRNA1498 406 PciiaRGSTNEVIANGihgtrnGALQLMQAELHVLSPLVPvREVNFLRFCKQHAEGVWAVVDVSIDSIRETSGATSFMNCRKLPS 490
                               **********************************************************************999************ PP

                               EEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                     START 151 giliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                               g+++++++ng+skvtwveh++++++++h+l+r+l++sg+ +ga +wvatlqrqce+
  Tp57577_TGAC_v2_mRNA1498 491 GCVVQDMPNGYSKVTWVEHAEYEENQVHQLYRPLLSSGMGFGAARWVATLQRQCEC 546
                               ******************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.24E-20104176IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.9E-22108176IPR009057Homeodomain-like
PROSITE profilePS5007117.216116176IPR001356Homeobox domain
SMARTSM003899.9E-18117180IPR001356Homeobox domain
PfamPF000461.1E-18119174IPR001356Homeobox domain
CDDcd000861.37E-17119176No hitNo description
PROSITE patternPS000270151174IPR017970Homeobox, conserved site
PROSITE profilePS5084843.397313549IPR002913START domain
SuperFamilySSF559617.36E-33315546No hitNo description
CDDcd088758.37E-126317545No hitNo description
PfamPF018526.7E-55322546IPR002913START domain
SMARTSM002343.6E-47322546IPR002913START domain
SuperFamilySSF559611.04E-7605675No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 688 aa     Download sequence    Send to blast
MSFGGFVENN SGGGCGGVRN NNIGEISYNN ERMPFGSFSQ PRLVTTPALA KSMFNSPGLS  60
LALQTNIDGQ EDVNRSMHEN FEQNGLRRSR EEEQSRSGSD NLDGVSGDEQ DADDKPPRKK  120
RYHRHTPQQI QELEALFKEC PHPDEKQRLE LSKRLCLETR QVKFWFQNRR TQMKTQLERH  180
ENNLLRQEND KLRAENMSIR DAMRNPICSN CGGLAMIGEI SLEEQHLRIE NARLKDELDR  240
VCALAGKFLG RPISSLPNSS LELGVGGNNN NGFNVMNNVS STLPDFSAGM SNNPLAIVSP  300
STRQTPLVGG FDRSVERSMF LELALTAMDE LVKMAQTSEP LWIRSIEGGR EILNHEEYMR  360
TFTPCIGLKP NGFVSEASRE TGTVIINSLA LVETLMDSNR WIEMFPCIIA RGSTNEVIAN  420
GIHGTRNGAL QLMQAELHVL SPLVPVREVN FLRFCKQHAE GVWAVVDVSI DSIRETSGAT  480
SFMNCRKLPS GCVVQDMPNG YSKVTWVEHA EYEENQVHQL YRPLLSSGMG FGAARWVATL  540
QRQCECLAIL MSXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX XXXXXXXXXX  600
XXXXXEPPGI VLSAATSVWL PVSPQRLFDF LRDERLRSEW DILSNGGPMQ EMAHIAKGQD  660
HGNCVSLLRA SVSFFLFLFL YINIYMK*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in the regulation of the tissue-specific accumulation of anthocyanins and in cellular organization of the primary root. {ECO:0000269|PubMed:10402424}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA1498
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013444922.10.0homeobox-leucine zipper protein ANTHOCYANINLESS 2
SwissprotQ0WV120.0ANL2_ARATH; Homeobox-leucine zipper protein ANTHOCYANINLESS 2
TrEMBLA0A072TNH20.0A0A072TNH2_MEDTR; Homeobox leucine zipper protein
TrEMBLA0A2K3PEC10.0A0A2K3PEC1_TRIPR; Homeobox-leucine zipper protein anthocyaninless 2-like (Fragment)
STRINGXP_004510857.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF119234106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00730.20.0HD-ZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]