PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA14971
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family WOX
Protein Properties Length: 254aa    MW: 29095.4 Da    PI: 8.011
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA14971genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.53.4e-212988357
                               --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                   Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                               +R+++tkeq+  Le+l+++  ++psaee+++++++l    +++ ++V++WFqN++a++++
  Tp57577_TGAC_v2_mRNA14971 29 SRWNPTKEQISMLENLYKQgIKTPSAEEIQQITARLrvygHIEGKNVFYWFQNHKARQRQ 88
                               8*****************99**************************************97 PP

2Wus_type_Homeobox114.93.9e-372790265
          Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                               +++RW+Pt+eQi +Le+lyk+G++tP++eeiq+ita+L+ yG+ie+kNVfyWFQN+kaR+rqkq
  Tp57577_TGAC_v2_mRNA14971 27 SSSRWNPTKEQISMLENLYKQGIKTPSAEEIQQITARLRVYGHIEGKNVFYWFQNHKARQRQKQ 90
                               689***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.71E-132393IPR009057Homeodomain-like
PROSITE profilePS5007111.6772489IPR001356Homeobox domain
SMARTSM003892.1E-72693IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.9E-92988IPR009057Homeodomain-like
PfamPF000466.4E-192988IPR001356Homeobox domain
CDDcd000864.97E-73090No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
LKMESDNNSN EMMMMMNENN GSSSSSSSSR WNPTKEQISM LENLYKQGIK TPSAEEIQQI  60
TARLRVYGHI EGKNVFYWFQ NHKARQRQKQ KQDNMAYFNR LLHRPHPIYP SPPIYPNAIC  120
TQYCVPQPQS QEFNYYPQNP KVLLPPAVSY RRNQAEKIMS NGMSNSICNN PLVYNENNMQ  180
KRISDYETLD LFPLHPTGIL EGKTTNNNVS SIVSVSADTH HSGSSHHVIN QDDGCHENQP  240
FFDFFNNSAG QRS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA14971
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004505911.21e-104WUSCHEL-related homeobox 2
TrEMBLA0A2K3LSI81e-160A0A2K3LSI8_TRIPR; WUSCHEL-related homeobox 2-like protein
STRINGXP_004505911.11e-104(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF82563044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-46WUSCHEL related homeobox 2