PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA14838
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family SBP
Protein Properties Length: 521aa    MW: 56862.9 Da    PI: 6.4134
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA14838genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.19.4e-42157232277
                                -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                        SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                Cqv gC++dls +k+yh+rhkvC++hsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q
  Tp57577_TGAC_v2_mRNA14838 157 CQVYGCNKDLSGCKDYHKRHKVCDIHSKTSKVIVNGIEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPQ 232
                                **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.2E-32151218IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.171154231IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.79E-39155235IPR004333Transcription factor, SBP-box
PfamPF031102.0E-30157230IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 521 aa     Download sequence    Send to blast
MDSWSFVPED NKGYVSKASI LGWELKTPSS FLGQQNIEND NNQGFEELGF HGMLGKQFSN  60
VIDVDDDVVD DVHRRKMGND VMAAPNAFSG RELSNSLGDT NGCNSIIDLK LGRFGEHGDA  120
IGTSFSKGTA ILSSSGSSST PPKRVRSSSV HSQVAYCQVY GCNKDLSGCK DYHKRHKVCD  180
IHSKTSKVIV NGIEQRFCQQ CSRFHLLVEF DDGKRSCRKR LAGHNERRRK PQVGIHSGRA  240
GRLLQSYSDS RFQGSMLTSA SFICQELLPS EVLSSEKCGT SNWWRPIKGE DETGTGFRPP  300
SSIPNTNAHP HSQTLFPSYS NKQFPFLHEN GAASATGSMF CENNTQYPPI LGGSSSGSQS  360
LFQDTSLGSE DFHVFETEST VQGLSGVSDG GCALSLLSSQ SQNSSSQSSV IPMPRPLVIP  420
SSHYSMSGVS DRFPSELNPT DGSHLSPILI SDNDEIVHFE MADGIFQGSD FGNVKDRLSC  480
EDGTTIDLLQ LSSQLQRVEH QRRALQVKQE NDSSCSLRIT *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-28148230284squamosa promoter binding protein-like 4
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA14838
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-40AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004488431.10.0teosinte glume architecture 1-like
TrEMBLA0A2K3MQN90.0A0A2K3MQN9_TRIPR; Squamosa promoter-binding-like protein 6-like
STRINGXP_004488431.10.0(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.14e-49SBP family protein