PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA1462
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family M-type_MADS
Protein Properties Length: 351aa    MW: 40631.1 Da    PI: 8.614
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA1462genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF48.51.1e-151151343
                              --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS
                    SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43
                              i+ +  r++tf kR+ g+lKK +E  +LCd++v+vi+++++
  Tp57577_TGAC_v2_mRNA1462 11 IQREKSRKITFQKRKSGLLKKVNEFAILCDVDVCVILYAPN 51
                              667788********************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006620.619161IPR002100Transcription factor, MADS-box
SMARTSM004321.3E-18160IPR002100Transcription factor, MADS-box
CDDcd002661.82E-20278No hitNo description
SuperFamilySSF554554.19E-202100IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-13323IPR002100Transcription factor, MADS-box
PfamPF003192.0E-171151IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-132338IPR002100Transcription factor, MADS-box
PRINTSPR004049.3E-133859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MGRGRISMEL IQREKSRKIT FQKRKSGLLK KVNEFAILCD VDVCVILYAP NFEGQGYAEP  60
ETWPKEKRDV QKILQKYYNT TMDRRHKIYD VQEYFKERMK KVEFDISKVR KEMLKIMYPT  120
WDESFDSLRE EQMRSFASIL DAKLEACNQK MNMLKGDVKG KTIAHESYKV DKPNTSYLTS  180
TPNSYINLMQ NSMSQAQIYP PMMNIGDKNP LGFWPLQLGQ SSQPSSSTLS SAQGSYQVES  240
DEGRYTQSYP GKQVDNSWAK WVSHVDPNIF LDPKTDTQKK DEAENGENLS PYSNIYNGNP  300
MTMQSYPIGM HTLPFQNLPN LPPQGYQING FYDMDMLQAH MFNNYMDGRK *
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA1462
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013451327.10.0floral homeotic protein AGAMOUS
TrEMBLA0A2K3LJI20.0A0A2K3LJI2_TRIPR; MADS-box transcription factor
STRINGXP_004516685.11e-179(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53431111
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G55690.12e-26M-type_MADS family protein