PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA14548
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 143aa    MW: 15731.8 Da    PI: 7.013
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA14548genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260141.72.2e-449107199
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrrkC++dC++apyfp e+p+kf nvhk+FGasnv+k+l+++ +++red+++sl+yeAear++dPvyG+vg i+ lq
  Tp57577_TGAC_v2_mRNA14548   9 PCAACKFLRRKCNQDCIFAPYFPPEEPQKFVNVHKIFGASNVSKFLNEVLPHQREDTVNSLAYEAEARIKDPVYGCVGAISVLQ 92 
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallke 99 
                                +ql +l++el+++++
  Tp57577_TGAC_v2_mRNA14548  93 KQLIRLQKELDATNA 107
                                **********99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.3998109IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-439106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 143 aa     Download sequence    Send to blast
MASSYSSSPC AACKFLRRKC NQDCIFAPYF PPEEPQKFVN VHKIFGASNV SKFLNEVLPH  60
QREDTVNSLA YEAEARIKDP VYGCVGAISV LQKQLIRLQK ELDATNADLI SITHQGSISL  120
GLGHVDHSNA FLNYPSNLSN DM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1743421e-141AC174342.16 Medicago truncatula chromosome 6 clone mth2-166e17, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003618148.25e-90lateral organ boundaries (LOB) domain protein
SwissprotQ8L8Q33e-65LBD25_ARATH; LOB domain-containing protein 25
TrEMBLG7KQ016e-90G7KQ01_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGPOPTR_0001s35280.16e-70(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF109134112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.11e-63LOB domain-containing protein 25