PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA13792
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Trihelix
Protein Properties Length: 277aa    MW: 33435.6 Da    PI: 7.3077
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA13792genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix772.8e-2440122186
                   trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdq 84 
                                +W+ +e+++ +++r e+++++ ++k++k+lW+ +s++++e+g++rs++qCk+kw+nl +ryk ++++e +     ++++p++++
  Tp57577_TGAC_v2_mRNA13792  40 QWSIEETKEFLTIRAELDQTFMETKRNKQLWDVISNHLKEKGYHRSAEQCKCKWKNLVTRYKGCETMETEA---MRHQFPFYNE 120
                                7********************************************************************95...45579****9 PP

                   trihelix  85 le 86 
                                l+
  Tp57577_TGAC_v2_mRNA13792 121 LQ 122
                                97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.00223799IPR001005SANT/Myb domain
CDDcd122039.64E-2239104No hitNo description
PfamPF138371.2E-2040124No hitNo description
PROSITE profilePS500907.8984197IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MEGHHQFHHK NQRQQQNLHL HQNISSTTIN VVDVVDRFPQ WSIEETKEFL TIRAELDQTF  60
METKRNKQLW DVISNHLKEK GYHRSAEQCK CKWKNLVTRY KGCETMETEA MRHQFPFYNE  120
LQEIFTSRMQ RMLWAEAEEG SKKKATQLST DDEEAEESEA ISQKGRNRKK KKAKIVSESG  180
GSSNSFFTNL KEILDEFMRQ QLQIEAQWME AFEARENERK LREMEWRQQM EVLENERILM  240
EQRWREREEQ RRIRDEARAE KRDALITALL NRLERQ*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004506754.11e-148PREDICTED: trihelix transcription factor GT-3b
SwissprotO804504e-71TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLG7JN341e-137G7JN34_MEDTR; Trihelix transcription factor GT-3a-like protein
STRINGGLYMA03G07590.21e-120(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.17e-65Trihelix family protein