PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA13490
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family HD-ZIP
Protein Properties Length: 290aa    MW: 32793.5 Da    PI: 4.8628
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA13490genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.42.8e-19131185256
                                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                rk+ ++tkeq e+Lee F++++++++++++ LA+kl+L+ rqV vWFqNrRa+ k
  Tp57577_TGAC_v2_mRNA13490 131 RKKLRLTKEQSEVLEENFKEHSTLNQKQKQALAQKLNLQARQVEVWFQNRRARTK 185
                                78889************************************************98 PP

2HD-ZIP_I/II1154.6e-37131219189
                HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekev 84 
                                +kk+rl+keq+++LEe+F+e+++L++++K++la++L+lq+rqv+vWFqnrRARtk+kq+E+d+e Lk+++++l+een +L+ke 
  Tp57577_TGAC_v2_mRNA13490 131 RKKLRLTKEQSEVLEENFKEHSTLNQKQKQALAQKLNLQARQVEVWFQNRRARTKLKQTESDFEELKKCCETLTEENMKLQKEL 214
                                69********************************************************************************** PP

                HD-ZIP_I/II  85 eeLre 89 
                                +eL++
  Tp57577_TGAC_v2_mRNA13490 215 QELKS 219
                                ***94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.92E-17127188IPR009057Homeodomain-like
PROSITE profilePS5007117.589127187IPR001356Homeobox domain
SMARTSM003891.3E-15129191IPR001356Homeobox domain
CDDcd000861.82E-16130188No hitNo description
Gene3DG3DSA:1.10.10.604.5E-17131185IPR009057Homeodomain-like
PfamPF000469.0E-17131185IPR001356Homeobox domain
PROSITE patternPS000270162185IPR017970Homeobox, conserved site
SMARTSM003406.6E-14187230IPR003106Leucine zipper, homeobox-associated
PfamPF021834.5E-8187220IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MMNFDDTSNT SFHVDLDLGL ALHDQYFDGH RKRESKKKEE NPSKYNIAYP SLTLGPSNEE  60
DEENTNYIIL DSASKIESCD QNLLTSLSIE SSFSNSTSMK KETCEELEVE VEIEKVPIPK  120
VGNVDEDGNP RKKLRLTKEQ SEVLEENFKE HSTLNQKQKQ ALAQKLNLQA RQVEVWFQNR  180
RARTKLKQTE SDFEELKKCC ETLTEENMKL QKELQELKSM QTVATTTTPF YMQIPAATLT  240
ICPSCETICG GNNNNNNGTT TLLIGSKGHG LYKNNDDNYQ FPHSSSAAC*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1179187RRARTKLKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
UniProtProbable transcription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA13490
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
UniProtINDUCTION: In leaves by drought stress. {ECO:0000269|PubMed:17999151}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013465933.11e-147homeobox-leucine zipper protein HOX15
SwissprotA2XE765e-56HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL45e-56HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLA0A072VD791e-146A0A072VD79_MEDTR; Homeobox associated leucine zipper protein
STRINGXP_004498976.11e-102(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114433107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.11e-46homeobox from Arabidopsis thaliana