PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA12081
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family WOX
Protein Properties Length: 406aa    MW: 45176.3 Da    PI: 8.606
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA12081genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.64.4e-1852112257
                                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
                   Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                                ++R+++++eq+++Le+ F++   +p +ee++++ ++l    ++ +++V++WFqNr+ + k+
  Tp57577_TGAC_v2_mRNA12081  52 KPRWNPKPEQIRILEAIFNSgMVNPPREEIRKIRAQLqeygQVGDANVFYWFQNRKSRSKH 112
                                89*****************99*************************************995 PP

2Wus_type_Homeobox111.83.7e-3651113264
          Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64 
                                +++RW+P+peQi+iLe++++sG+++P++eei++i+a+L+eyG+++d+NVfyWFQNrk+R+++k
  Tp57577_TGAC_v2_mRNA12081  51 PKPRWNPKPEQIRILEAIFNSGMVNPPREEIRKIRAQLQEYGQVGDANVFYWFQNRKSRSKHK 113
                                689**********************************************************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.5E-734111IPR009057Homeodomain-like
SuperFamilySSF466894.02E-1246116IPR009057Homeodomain-like
PROSITE profilePS5007110.73848113IPR001356Homeobox domain
SMARTSM003894.8E-950117IPR001356Homeobox domain
CDDcd000861.85E-851113No hitNo description
PfamPF000461.0E-1552112IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0030010Biological Processestablishment of cell polarity
GO:0048825Biological Processcotyledon development
GO:0090451Biological Processcotyledon boundary formation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 406 aa     Download sequence    Send to blast
MASSNRHWPS MFKSKPCNTH HQWQHDINSS LISSSACHRT PYSGEERSAE PKPRWNPKPE  60
QIRILEAIFN SGMVNPPREE IRKIRAQLQE YGQVGDANVF YWFQNRKSRS KHKLRHLQNQ  120
NSKNQNQNQN QNLQNQEHHA PQQNSVSSLS QITTAPSSSS SSSEKSPPKE LIPSKVFSLG  180
FTNINDVVPN SPTASVNQNY FHPQNETNLL PTPQVTAPTE TFFFPMQNHV LPVTNNVTSQ  240
SQGFCFSELS NMVHHQPQQN NTAHCTAGIL LSEIMNNHGA TNSSKKEQVH HDKNVKIMHQ  300
TPHFNFCFAP STTTVAPPTS SSTITVPSPI TSQLQGIGEV GVAAKSMVFI NDVAFEVASG  360
PFNVRQAFGD DAILINSTGQ PVLTNQWGVT LHSLQHGACY YVVIW*
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA12081
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024631536.10.0WUSCHEL-related homeobox 9
TrEMBLA0A2K3ME040.0A0A2K3ME04_TRIPR; WUSCHEL-related homeobox 9-like protein (Fragment)
STRINGAES639370.0(Medicago truncatula)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38243361
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33880.11e-61homeobox-3