PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA1206
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 158aa    MW: 18115.5 Da    PI: 7.299
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA1206genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601247.5e-3951051101
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk +rr+C++dC+++pyfpa++p++fa+vhk++G snv k+l++lpe  re+a+++l+ eA++r++dPvyG+vg+++kl q
  Tp57577_TGAC_v2_mRNA1206   5 RCAACKSQRRRCPSDCIFSPYFPANDPQRFAYVHKIYGGSNVGKMLQQLPEYLREQAVNTLYLEARCRIQDPVYGCVGIVSKLYQ 89 
                               6************************************************************************************ PP

                    DUF260  86 qleqlkaelallkeel 101
                               q++ +++ela++++++
  Tp57577_TGAC_v2_mRNA1206  90 QIHDTEVELAKIQTQI 105
                               ***********99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.0854105IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-385102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MIYGRCAACK SQRRRCPSDC IFSPYFPAND PQRFAYVHKI YGGSNVGKML QQLPEYLREQ  60
AVNTLYLEAR CRIQDPVYGC VGIVSKLYQQ IHDTEVELAK IQTQIAYHKL QNQQIEVESN  120
FNALSTVDAE TNLNFLPTQS NSMEQFQWPN QVPNLFN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150361e-50AP015036.1 Vigna angularis var. angularis DNA, chromosome 3, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004491406.15e-97PREDICTED: LOB domain-containing protein 23-like
SwissprotP594672e-47LBD23_ARATH; LOB domain-containing protein 23
TrEMBLG7K3J31e-88G7K3J3_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA14G02440.25e-71(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26620.11e-48LOB domain-containing protein 23