PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA12050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family VOZ
Protein Properties Length: 372aa    MW: 41550.1 Da    PI: 8.0693
Description VOZ family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA12050genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1VOZ210.64.5e-6514632145217
                        VOZ  45 gttpvlrpkgidlkdgllfaalsakvqgkevgipecegaatakspwnaaelf.dl..sllegetirewlffdkprrafesgnrk 125
                                 ++pvlrp gi+l d+ll+aalsa ++gk+vgipecegaa akspwna+ +   l   +l    +   + +  p   +      
  Tp57577_TGAC_v2_mRNA12050 146 AVAPVLRPSGIGLNDNLLLAALSANAKGKDVGIPECEGAAVAKSPWNAPGISiSLifLFLRVRLLGGGFSLISPEAHLRVETES 229
                                578**********************************************98513311345566666777788999999999999 PP

                        VOZ 126 qrslpdysgrgwhesrkqvmkefgglkrsyymdpqpsssfewhlyeyeineldalalyrlelklvdekksakgkvskdsladlq 209
                                +  lpdy+grgw esrk+vm+efg lkrsyymdpqp+++fewhlyeyei+++ + aly le+k vd+kks+k+k+++ds++++q
  Tp57577_TGAC_v2_mRNA12050 230 KGPLPDYNGRGWRESRKHVMNEFGELKRSYYMDPQPLNHFEWHLYEYEISKCYSHALYWLEFKCVDGKKSSKAKITSDSVTNMQ 313
                                9*********************************************************************************** PP

                        VOZ 210 kklgrlta 217
                                 ++grl+a
  Tp57577_TGAC_v2_mRNA12050 314 TQIGRLSA 321
                                ******97 PP

Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MKKIPKGSCK TASHRLFKDK AKNHVDDLQV MFLDLQFARK ESRSIDAALL EEQVHQILWE  60
WRAGLNEPSS AASLKQGRSH GSLSTDICRL LQLCEDEDDA TSLLVVPRPE PNDQTMQTVE  120
DAKAQNVHFW IVQGPHKGWT CVRTFAVAPV LRPSGIGLND NLLLAALSAN AKGKDVGIPE  180
CEGAAVAKSP WNAPGISISL IFLFLRVRLL GGGFSLISPE AHLRVETESK GPLPDYNGRG  240
WRESRKHVMN EFGELKRSYY MDPQPLNHFE WHLYEYEISK CYSHALYWLE FKCVDGKKSS  300
KAKITSDSVT NMQTQIGRLS AEFPYDSRRS AKGRAKTDAK ADIGGVYTAS NNAPSPYDYL  360
VENTNDYYVS K*
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator acting positively in the phytochrome B signaling pathway. Functions redundantly with VOZ2 to promote flowering downstream of phytochrome B (phyB). Down-regulates 'FLOWERING LOCUS C' (FLC) and up-regulates 'FLOWERING LOCUS T' (FT). Binds to the 38-bp cis-acting region of the AVP1 gene. Interacts with phyB in the cytoplasm and is translocated to the nucleus at signal transmission, where it is subjected to degradation in a phytochrome-dependent manner. {ECO:0000269|PubMed:15295067, ECO:0000269|PubMed:22904146}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA12050
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By far-red light. {ECO:0000269|PubMed:22904146}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006588835.11e-107transcription factor VOZ1 isoform X3
RefseqXP_028182193.11e-107transcription factor VOZ1-like isoform X3
SwissprotQ9SGQ01e-72VOZ1_ARATH; Transcription factor VOZ1
TrEMBLA0A2K3MPD60.0A0A2K3MPD6_TRIPR; Transcription factor VOZ1-like protein
STRINGGLYMA07G32374.24e-87(Glycine max)
STRINGXP_007153891.15e-87(Phaseolus vulgaris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14983494
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28520.26e-65vascular plant one zinc finger protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Yasui Y,Kohchi T
    VASCULAR PLANT ONE-ZINC FINGER1 and VOZ2 repress the FLOWERING LOCUS C clade members to control flowering time in Arabidopsis.
    Biosci. Biotechnol. Biochem., 2014. 78(11): p. 1850-5
    [PMID:25351333]
  3. Kumar S,Choudhary P,Gupta M,Nath U
    VASCULAR PLANT ONE-ZINC FINGER1 (VOZ1) and VOZ2 Interact with CONSTANS and Promote Photoperiodic Flowering Transition.
    Plant Physiol., 2018. 176(4): p. 2917-2930
    [PMID:29507119]
  4. Song C,Lee J,Kim T,Hong JC,Lim CO
    VOZ1, a transcriptional repressor of DREB2C, mediates heat stress responses in Arabidopsis.
    Planta, 2018. 247(6): p. 1439-1448
    [PMID:29536220]