PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA11730
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 342aa    MW: 37776.3 Da    PI: 8.4935
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA11730genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.91.5e-42271261100
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk+lrrkC+++Cv+apyfp ++p++fa+vhk+FGasnv kll++l+ ++r+da++sl+yeAear+rdPvyG+vg+i+ lq
  Tp57577_TGAC_v2_mRNA11730  27 PCAACKFLRRKCTQECVFAPYFPPDNPQRFAYVHKVFGASNVAKLLNELNATQRDDAVKSLAYEAEARLRDPVYGCVGLISLLQ 110
                                7*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkee 100
                                ++l+  + el+ +k+e
  Tp57577_TGAC_v2_mRNA11730 111 HKLRAIQGELNNAKKE 126
                                ***********99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.48326127IPR004883Lateral organ boundaries, LOB
PfamPF031951.8E-4227124IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009954Biological Processproximal/distal pattern formation
GO:0009965Biological Processleaf morphogenesis
GO:0048441Biological Processpetal development
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
LVSERRRGRE KKKLRDRQKM SSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DNPQRFAYVH  60
KVFGASNVAK LLNELNATQR DDAVKSLAYE AEARLRDPVY GCVGLISLLQ HKLRAIQGEL  120
NNAKKELATY IGPQALQSIP ATMLQQQQQH NNPFGGNSLY PYNGNVPAVT AANQMVIRDP  180
QPPLQQQILD PHQLAVAVAA REQQDIFRTF ENQQQQQEFL RFSGGFDVDS VSNSAGGFTP  240
VSAGTGVGGG VVASDQLAPS LALGSFDNTY HHMQQSQQGQ GESHPHHQQH HNHHLPLQAQ  300
LLLPPQQKQA QPQTQHSPLI HHHQQQTESE ECRSVGLGPS C*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1814REKKKLR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU0135150.0CU013515.2 Medicago truncatula chromosome 5 clone mth2-106f22, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004511963.11e-147PREDICTED: LOB domain-containing protein 36-like
RefseqXP_004511964.11e-147PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ31e-69LBD36_ARATH; LOB domain-containing protein 36
TrEMBLG7K8301e-146G7K830_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA11G06210.21e-130(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23533484
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.17e-70ASYMMETRIC LEAVES 2-like 1