PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA11601
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family LBD
Protein Properties Length: 148aa    MW: 16874.1 Da    PI: 7.7463
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA11601genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260121.83.7e-3851051101
                     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklq 84 
                                +CaaCk +rr+C++dC+++pyfp ++p+kfa vh+++G snv k+l++lp+  re+a+++l+ eA++r++dPvyG+vg+i+kl 
  Tp57577_TGAC_v2_mRNA11601   5 RCAACKSQRRRCPSDCIFSPYFPPNDPQKFASVHRIYGGSNVGKMLQQLPHCVREQAANTLYLEAQCRIQDPVYGCVGIISKLY 88 
                                6*********************************************************************************** PP

                     DUF260  85 qqleqlkaelallkeel 101
                                qq++++++ela++++++
  Tp57577_TGAC_v2_mRNA11601  89 QQIHETEVELAKIQTQI 105
                                ************99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.0474105IPR004883Lateral organ boundaries, LOB
PfamPF031952.7E-385102IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MIYGRCAACK SQRRRCPSDC IFSPYFPPND PQKFASVHRI YGGSNVGKML QQLPHCVREQ  60
AANTLYLEAQ CRIQDPVYGC VGIISKLYQQ IHETEVELAK IQTQIAYYKF QNQQFEAESN  120
LSSLAPQGNN MEMEHFQWPS QALNYSN*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00381DAPTransfer from AT3G26620Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU1798947e-67CU179894.1 Medicago truncatula chromosome 5 clone mth4-21m22, COMPLETE SEQUENCE.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004491406.17e-84PREDICTED: LOB domain-containing protein 23-like
SwissprotP594683e-48LBD24_ARATH; LOB domain-containing protein 24
TrEMBLG7K3J33e-82G7K3J3_MEDTR; Lateral organ boundaries (LOB) domain protein
STRINGGLYMA14G02440.22e-65(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-49LOB domain-containing protein 24