PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA10927
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family NF-YB
Protein Properties Length: 166aa    MW: 18050.2 Da    PI: 6.1214
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA10927genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB185.93.1e-5816111297
                      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkv 85 
                                +eqdrflPianvsrimkk+lPanakisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfedyveplk+
  Tp57577_TGAC_v2_mRNA10927  16 KEQDRFLPIANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKI 99 
                                79********************************************************************************** PP

                      NF-YB  86 ylkkyrelegek 97 
                                yl+kyre+egek
  Tp57577_TGAC_v2_mRNA10927 100 YLSKYREMEGEK 111
                                **********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.4E-5511121IPR009072Histone-fold
SuperFamilySSF471132.33E-4218123IPR009072Histone-fold
PfamPF008083.1E-282185IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.8E-214967No hitNo description
PROSITE patternPS0068505268IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.8E-216886No hitNo description
PRINTSPR006151.8E-2187105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MAESDNESGG GQTGYKEQDR FLPIANVSRI MKKALPANAK ISKEAKETVQ ECVSEFISFI  60
TGEASDKCQK EKRKTINGDD LLWAMTTLGF EDYVEPLKIY LSKYREMEGE KSAMIGRSDH  120
RDHGNVGEGS GGVYNHGVGV SSSMMMMMGH NMYGSGSGSP SFGRN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B1e-5016106292Transcription factor HapC (Eurofung)
4g92_B1e-5016106292Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ9182860.0JQ918286.1 Medicago truncatula nuclear transcription factor Y subunit B13 (NF-YB13) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004486346.16e-94PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233106e-71NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLI3TAX12e-87I3TAX1_MEDTR; Nuclear transcription factor Y protein
STRINGGLYMA09G01650.12e-77(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.11e-71nuclear factor Y, subunit B3