PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA10715
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family HD-ZIP
Protein Properties Length: 296aa    MW: 34094.8 Da    PI: 6.9369
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA10715genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.61.1e-1898150456
                                -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                   Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                + +++ eq+++Le+ Fe  +++  +++ +LAk lgL+ rqV +WFqNrRa++k
  Tp57577_TGAC_v2_mRNA10715  98 KKRLSLEQVKALEKSFEIGNKLEPDRKMQLAKALGLQPRQVAIWFQNRRARWK 150
                                556899**********************************************9 PP

2HD-ZIP_I/II129.71.2e-4196188193
                HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekev 84 
                                ekk+rls eqvk+LE+sFe  +kLep+rK++la++Lglqprqva+WFqnrRAR+ktkqlEk+ye+Lk+++++lk++n++L++++
  Tp57577_TGAC_v2_mRNA10715  96 EKKKRLSLEQVKALEKSFEIGNKLEPDRKMQLAKALGLQPRQVAIWFQNRRARWKTKQLEKEYEVLKKQFESLKADNDSLKAQN 179
                                69********************************************************************************** PP

                HD-ZIP_I/II  85 eeLreelke 93 
                                ++L++el++
  Tp57577_TGAC_v2_mRNA10715 180 HKLHAELQT 188
                                *****9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.11E-1989154IPR009057Homeodomain-like
PROSITE profilePS5007117.02292152IPR001356Homeobox domain
SMARTSM003899.6E-1995156IPR001356Homeobox domain
CDDcd000869.40E-1697153No hitNo description
PfamPF000467.8E-1698150IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.2E-20104151IPR009057Homeodomain-like
PRINTSPR000318.4E-6123132IPR000047Helix-turn-helix motif
PROSITE patternPS000270127150IPR017970Homeobox, conserved site
PRINTSPR000318.4E-6132148IPR000047Helix-turn-helix motif
PfamPF021832.6E-15152192IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009733Biological Processresponse to auxin
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MAFPPSHTFI FQTHEDHHHD HLHSSSSSLN SFPSFPPHQH FQGSGNHGGA SYMMKRSMSF  60
SGIENNHNHM NNKCDELMHG DEDQLSDEEG YSQLGEKKKR LSLEQVKALE KSFEIGNKLE  120
PDRKMQLAKA LGLQPRQVAI WFQNRRARWK TKQLEKEYEV LKKQFESLKA DNDSLKAQNH  180
KLHAELQTLK NRDCFENGTI SLKKENECSW SNGSDNSSDM NLDLSRTQIM SSPLSSQNGK  240
TLLQTSLKPT SMTQLLQSST RSDLQDESFC NMFHNIDEQQ SLWPWTDHQQ QHHFQ*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1144152RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00322DAPTransfer from AT3G01220Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA10715
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin. {ECO:0000269|PubMed:12644682}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1484820.0BT148482.1 Medicago truncatula clone JCVI-FLMt-17G6 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013450953.11e-178homeobox-leucine zipper protein HAT7
SwissprotQ8LAT05e-81ATB20_ARATH; Homeobox-leucine zipper protein ATHB-20
TrEMBLA0A2K3PC660.0A0A2K3PC66_TRIPR; Homeobox-leucine zipper protein HAT7-like
STRINGXP_004489381.11e-158(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.13e-69homeobox 3