PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp57577_TGAC_v2_mRNA10141
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium
Family Trihelix
Protein Properties Length: 386aa    MW: 43590.5 Da    PI: 9.3871
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp57577_TGAC_v2_mRNA10141genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix44.54.2e-1453162278
                   trihelix   2 WtkqevlaLiearr.........emeerlrrgk.................................lkkplWeevskkmrergf 43 
                                Wt qe+l Li+a++                  +                                 + + +W++v ++++++g+
  Tp57577_TGAC_v2_mRNA10141  53 WTIQETLILITAKKldderrlknT--------StststpssssqdqnrtttptttsacpstssnrnSGELRWKWVENYCWSHGC 128
                                *************96444333330........245556666667777777778888888888888899**************** PP

                   trihelix  44 erspkqCkekwenlnkrykkikegekkrtsessst 78 
                                 rs++qC++kw+nl ++ykk+++ e+k +s+s  +
  Tp57577_TGAC_v2_mRNA10141 129 LRSQNQCNDKWDNLLRDYKKVRDYESKSESQSP-N 162
                                **************************9755544.3 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-54964IPR009057Homeodomain-like
PfamPF138377.1E-952161No hitNo description
Gene3DG3DSA:1.10.10.604.4E-5108144IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MSDPSTSTTP LSHPSIIPNQ HNLPIIIHTT TTTQPPQPPP QPPSTREYRK GNWTIQETLI  60
LITAKKLDDE RRLKNTSTST STPSSSSQDQ NRTTTPTTTS ACPSTSSNRN SGELRWKWVE  120
NYCWSHGCLR SQNQCNDKWD NLLRDYKKVR DYESKSESQS PNKDHHHQHH HNFPSYWILN  180
KQQRKEQNLP SNMVFEIYQA ISDVLQRKQS QRITTPQHHH QQQGLVTLVS SPLPALPLQA  240
QLLPPPPPPP LPPPLPLQQP PPPPHAPASS TTPAVSERTE SESTDSEKSE GDEDDGGSES  300
KRRKVKNLGS SIMRSASVLA RALRRCEEKK EKRHRELIEI EQRRIQMEES RNEVHRQGIA  360
TLVAAVSNLS GAIHSFINSE HHGQR*
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp57577_TGAC_v2_mRNA10141
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2210135e-70KF221013.1 Glycine max cultivar Kwangkyo clone 1f1r hydroxyproline-rich glycoprotein family protein (Glyma20g32540) gene, partial cds.
GenBankKF2210145e-70KF221014.1 Glycine max cultivar Ilpumgeomjeong clone 1f1r hydroxyproline-rich glycoprotein family protein (Glyma20g32540) gene, partial cds.
GenBankKF2210165e-70KF221016.1 Glycine max cultivar PI96983 clone 1f1r hydroxyproline-rich glycoprotein family protein (Glyma20g32540) gene, partial cds.
GenBankKF2210185e-70KF221018.1 Glycine max cultivar Geomjeongol clone 1f1r hydroxyproline-rich glycoprotein family protein (Glyma20g32540) gene, partial cds.
GenBankKF2210205e-70KF221020.1 Glycine soja cultivar IT162825 clone 1f1r hydroxyproline-rich glycoprotein family protein (Glyma20g32540) gene, partial cds.
GenBankKF2210235e-70KF221023.1 Glycine soja cultivar IT182840 clone 1f1r hydroxyproline-rich glycoprotein family protein (Glyma20g32540) gene, partial cds.
GenBankKF2210245e-70KF221024.1 Glycine soja cultivar IT182848 clone 1f1r hydroxyproline-rich glycoprotein family protein (Glyma20g32540) gene, partial cds.
GenBankKF2210255e-70KF221025.1 Glycine soja cultivar IT182932 clone 1f1r hydroxyproline-rich glycoprotein family protein (Glyma20g32540) gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013469425.10.0trihelix transcription factor ASR3
TrEMBLA0A2K3MQ280.0A0A2K3MQ28_TRIPR; Trihelix transcription factor GTL1-like protein
STRINGXP_004496217.11e-162(Cicer arietinum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF68043242
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35640.18e-42Trihelix family protein