PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp_un0442_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family G2-like
Protein Properties Length: 281aa    MW: 31442.8 Da    PI: 7.4429
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp_un0442_001genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.64.9e-32115168255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt++LH++Fv+av+ LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Tp_un0442_001 115 PRMRWTSTLHAHFVHAVQLLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 168
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.79E-15112168IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-28113168IPR009057Homeodomain-like
TIGRFAMsTIGR015576.0E-24115168IPR006447Myb domain, plants
PfamPF002494.3E-7116167IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 281 aa     Download sequence    Send to blast
MMMLESRSSM RVSNSVPDLS LQISLPNSHA EKTLHGGDRS STTTSSDSGS SLSDLSHENN  60
FFKKPLLSLG FDHYHHHHHQ HQRHNSNMFQ PQIYGRDFKR TSSSMVGLKR SIRAPRMRWT  120
STLHAHFVHA VQLLGGHERA TPKSVLELMN VKDLTLAHVK SHLQMYRTVK CTDKGSSGDG  180
KVEKEAEQKI EDNNNNEEAD ADTNSPNSSS VQKTQRASWS STKGMSMSIS TQADPHMGTT  240
HHTKDDEEKE TTNAHLSLEF TLGRPSWGID YAEPSSDLTL L
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0260530.0BT026053.1 Arabidopsis thaliana At5g42630 mRNA, complete cds.
GenBankAY0486910.0AY048691.1 Arabidopsis thaliana GARP-like putative transcription factor KANADI4 (KAN4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002863758.11e-165hypothetical protein ARALYDRAFT_494773
SwissprotQ9FJV51e-164KAN4_ARATH; Probable transcription factor KAN4
TrEMBLD7MS191e-165D7MS19_ARALL; Putative uncharacterized protein
STRINGfgenesh2_kg.8__589__AT5G42630.11e-164(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65722844
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.11e-146G2-like family protein