PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp_un0302_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 290aa    MW: 33055.6 Da    PI: 9.3294
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp_un0302_001genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF54.91.1e-17950344
                   --SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
         SRF-TF  3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                   i+n+  r++tf kR+ng++KK +ELS+LC+++++ ii+s+ +
  Tp_un0302_001  9 ISNNYSRKITFQKRKNGVMKKVKELSTLCGINACAIIYSPYN 50
                   99*************************************965 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PRINTSPR004041.0E-7121IPR002100Transcription factor, MADS-box
PROSITE profilePS5006615.881147IPR002100Transcription factor, MADS-box
SMARTSM004322.9E-20158IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-23293IPR002100Transcription factor, MADS-box
CDDcd002669.88E-31283No hitNo description
PfamPF003193.3E-16950IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-72136IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MRKLKLALIS NNYSRKITFQ KRKNGVMKKV KELSTLCGIN ACAIIYSPYN SNPEVWPSES  60
GVRRVVSDFQ ELSEVDQRKK MVDQEIFLKQ RIAKASDQLK RQIKENREME MTEVMFQCLL  120
GRMRMFNLNV VDLNDLGYLI KKFITDLNRR IDILGNSSTE IGESSNDAVV AAAAPSERIG  180
SLAVVAATTT PATVIYEVGS SSSSAAAAAF FNPIQHQHYH QQFRRPAVPH VGLYEQLAIL  240
NQSHQQQPFM ETMNHPNQRS YVAEHMGFPF MDGNHHNCNH HHHHHNQPQQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_199678.11e-105AGAMOUS-like 80
SwissprotQ9FJK31e-106AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLS6B3Z31e-105S6B3Z3_TURGL; Agamous-like MADS-box protein AGL80 (Fragment)
TrEMBLS6C6761e-105S6C676_ARAHH; Agamous-like MADS-box protein AGL80 (Fragment)
STRINGXP_006408017.11e-105(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM7028415
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48670.12e-98AGAMOUS-like 80
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]