PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g35100
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 178aa    MW: 21251.3 Da    PI: 6.7329
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g35100genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF61.87.6e-20957149
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
               k+ie+  +r++ f+kR+ng+lKKA+ELS+ Cd+   +i +s+ gkl+ +
  Tp7g35100  9 KKIEDRQQRNIAFAKRKNGLLKKAYELSIFCDVPMVLIFYSPAGKLFIF 57
               68********************************************866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.5E-22160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006623.773161IPR002100Transcription factor, MADS-box
CDDcd001202.12E-20257No hitNo description
SuperFamilySSF554553.27E-20281IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-17323IPR002100Transcription factor, MADS-box
PfamPF003191.2E-181057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-172338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-173859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MGRVKIPMKK IEDRQQRNIA FAKRKNGLLK KAYELSIFCD VPMVLIFYSP AGKLFIFDAK  60
ARLQDEPFIR RWIDLMRSES LNREWMLRKN GEDEIRCQTR SKELEDEISE CKDELAKVEQ  120
QLGYFLKNPT QWESTDEIDY QEKILQETLD KVRSRKRKLF DASNWPFETE VESNTSSE
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp7g35100
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018454226.11e-75PREDICTED: agamous-like MADS-box protein AGL66
TrEMBLA0A3P6FJD66e-73A0A3P6FJD6_BRAOL; Uncharacterized protein
STRINGBra011763.1-P5e-67(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17254910
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77980.16e-27AGAMOUS-like 66