PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g34230
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 235aa    MW: 27081.6 Da    PI: 9.0269
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g34230genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF641.6e-201762449
               -SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
     SRF-TF  4 enksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
               + ks  qvtfskRr g++KKA+EL++LC++++++i+fs+ gk++ +
  Tp7g34230 17 KKKSSLQVTFSKRRFGLFKKASELCTLCGTKILMIVFSPGGKVFSF 62
               568888*************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006622.974666IPR002100Transcription factor, MADS-box
SMARTSM004328.6E-29665IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.96E-23792IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-16828IPR002100Transcription factor, MADS-box
PfamPF003195.1E-221662IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-162843IPR002100Transcription factor, MADS-box
PRINTSPR004041.8E-164364IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MVRNGKGRQR IEITKMKKKS SLQVTFSKRR FGLFKKASEL CTLCGTKILM IVFSPGGKVF  60
SFGHPNVRDL VYHLSGDNQN PHFLHQYNNN LLLVESRPDE NIERLNEKLT EVTAQEEEER  120
KKRKQLDAMR VTREQQGNWY EKDVKELDMN QTNHLISALL DVKRQLVSEI LEQSQMNVSQ  180
HYLGESSSNG GHAGGLDLFD QRRMLDLNAF DNNPNMLPPN YGPSFEYHNN GANNM
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp7g34230
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006411985.11e-108agamous-like MADS-box protein AGL62
TrEMBLV4ML361e-107V4ML36_EUTSA; Uncharacterized protein
STRINGXP_006411985.11e-108(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM142941022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36590.13e-92M-type_MADS family protein