PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g33330
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WOX
Protein Properties Length: 260aa    MW: 29035.1 Da    PI: 5.5722
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g33330genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.72.7e-2093153257
                T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
   Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                r+R+t+t+ ql++Le+ F + + +ps++++++++++l    ++ +++V++WFqNrRa+ k+
  Tp7g33330  93 RQRWTPTPVQLQILERIFDQgTGTPSKQKIKDITEELsqhgQIADQNVYNWFQNRRARSKR 153
                89*****************99**************************************97 PP

2Wus_type_Homeobox104.47.5e-3492155265
  Wus_type_Homeobox   2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        ar+RWtPtp Q++iLe+++++G+ tP+k++i++it+eL+++G+i d+NV++WFQNr+aR+++kq
          Tp7g33330  92 ARQRWTPTPVQLQILERIFDQGTGTPSKQKIKDITEELSQHGQIADQNVYNWFQNRRARSKRKQ 155
                        789***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-1689156IPR009057Homeodomain-like
PROSITE profilePS5007114.41489154IPR001356Homeobox domain
SMARTSM003894.3E-1391158IPR001356Homeobox domain
SuperFamilySSF466892.31E-1692155IPR009057Homeodomain-like
PfamPF000464.0E-1893153IPR001356Homeobox domain
CDDcd000864.37E-1293155No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MMEWDNQQQP NNHHSSNLQG IDVNGGSGSG GMYVKVMTDE QLETLRKQIA IYATICERLV  60
EMHKTLTSQQ DLAGGRLGGL YADPTIGHKM TARQRWTPTP VQLQILERIF DQGTGTPSKQ  120
KIKDITEELS QHGQIADQNV YNWFQNRRAR SKRKQHGVGS SNNNNGESEV ETETETLNEK  180
RKTPESLLVL PDGNNSNNAV GTTTTSPRPE DLCFQSPEMS SDLHLLGVLS NPRDEHLVGK  240
MGLSENYNLY DHVEDYGLSG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1146154RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00617PBMTransfer from AT4G35550Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0005380.0BT000538.1 Arabidopsis thaliana homeodomain - like protein (At4g35550/F8D20_60) mRNA, complete cds.
GenBankAY2514040.0AY251404.1 Arabidopsis thaliana WOX13 protein mRNA, complete cds.
GenBankAY0482680.0AY048268.1 Arabidopsis thaliana AT4g35550/F8D20_60 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013595483.11e-156PREDICTED: WUSCHEL-related homeobox 13-like
RefseqXP_010432267.11e-156PREDICTED: WUSCHEL-related homeobox 13-like
SwissprotO817881e-153WOX13_ARATH; WUSCHEL-related homeobox 13
TrEMBLA0A078C6A31e-156A0A078C6A3_BRANA; BnaC07g45680D protein
TrEMBLA0A0D3DHV01e-156A0A0D3DHV0_BRAOL; Uncharacterized protein
STRINGscaffold_700564.11e-155(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46202851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.11e-134WUSCHEL related homeobox 13