PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g32400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family TALE
Protein Properties Length: 515aa    MW: 57890.6 Da    PI: 6.6597
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g32400genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.11.4e-083303671954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+ +++  LA+++gL+  qV++WF N R +
  Tp7g32400 330 FEHflHPYPKDSDKIMLARQTGLSRGQVSNWFINARVR 367
                554459******************************88 PP

2BELL125.91.6e-40197268172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                erqe+q+k +kLls+l+eVd+r+kqy++q+q+v+ssF+++ag+g+akpYt+lAl++iSrhFr+L+dai++qi
  Tp7g32400 197 ERQEMQSKLTKLLSMLDEVDRRFKQYYQQMQIVVSSFDVIAGYGAAKPYTALALQTISRHFRSLRDAISGQI 268
                79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-67139266IPR006563POX domain
PfamPF075266.6E-46145265IPR006563POX domain
PROSITE profilePS5007111.791308371IPR001356Homeobox domain
CDDcd000866.78E-11311372No hitNo description
SMARTSM003898.4E-9311375IPR001356Homeobox domain
SuperFamilySSF466892.22E-16312377IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.7E-26314376IPR009057Homeodomain-like
PfamPF059209.8E-18328367IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MENYLDTRFL TGNAMIHMNP TVPYSEELAG RERTEANNVS ASQERQVLSR FGGISQMQDI  60
HDYGSWRDQA SGRNSFPLIS AMEGATGVHQ TGQGLSLSLG SQILPGIHQM SHQSMAPRAD  120
HFRGNEYATQ SFPGGNHNLD VVRTIPNSKY LKAAQQLLDE AVNVRKALKQ FQPEGDKNNE  180
NPQEPDQNPP AEISQSERQE MQSKLTKLLS MLDEVDRRFK QYYQQMQIVV SSFDVIAGYG  240
AAKPYTALAL QTISRHFRSL RDAISGQILV TRKCLGEQDG SDGNRVGIIS RLKYVDQHLR  300
QQRGFMQPQA WRPQRGLPEN SVLVLRAWLF EHFLHPYPKD SDKIMLARQT GLSRGQVSNW  360
FINARVRLWK PMVEEIYKEE FTENDSNSSS ENTPRRSEIR PVVADDEGRV QEFPQDRIKP  420
DNGPRYGVET CGMVQGGQMD GGQFMTSRFG GDGVSLTLGL QNSQGHDNVV AMSNEAYNSF  480
PGADIYENAI PGAEPEYVNP GSRQNRIGSS RYMIL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-14317375563Homeobox protein Meis2
3k2a_B1e-14317375563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3531440.0AK353144.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-17-H08.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412205.10.0hypothetical protein EUTSA_v10024906mg
SwissprotO656850.0BLH6_ARATH; BEL1-like homeodomain protein 6
TrEMBLV4MLP30.0V4MLP3_EUTSA; Uncharacterized protein
STRINGscaffold_700666.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28692563
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.20.0BEL1-like homeodomain 6