PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g30750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family TALE
Protein Properties Length: 480aa    MW: 54685.5 Da    PI: 6.5104
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g30750genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox25.42.4e-083984361854
                HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                +F++  ++yp+ +e+  LA + gLt +qV++WF N R +
  Tp7g30750 398 MFQNflHPYPKDSEKHLLAIRSGLTRSQVSNWFINARVR 436
                5887779******************************88 PP

2BELL88.95.5e-29273343172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                +r++l++kk++Ll+ll++Vd+rY+ + ++++tv+s+F+a+++l++ +++t++Al++iS+ +++L+++i+++i
  Tp7g30750 273 QRRALEAKKTHLLDLLQMVDDRYSNCIDEIHTVVSAFHAATELDP-QLHTRFALQTISFLYKNLRERISKKI 343
                6899*****************************************.***********************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.8E-49194341IPR006563POX domain
PfamPF075262.7E-27199340IPR006563POX domain
PROSITE profilePS5007110.981377440IPR001356Homeobox domain
SMARTSM003897.1E-5380444IPR001356Homeobox domain
CDDcd000867.92E-10380441No hitNo description
SuperFamilySSF466896.42E-15381449IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-25383446IPR009057Homeodomain-like
PfamPF059201.6E-14397436IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009640Biological Processphotomorphogenesis
GO:0010073Biological Processmeristem maintenance
GO:0010227Biological Processfloral organ abscission
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010371Biological Processregulation of gibberellin biosynthetic process
GO:0090470Biological Processshoot organ boundary specification
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MENDNTFSCL DNVMTNQNPL LMDFIPSRED STSYSTMLPW TAMRPDPLQM GAFDIFNSFL  60
TNKYLSSTSR SINVQETRNV ESFEVMAPPP PPLHHLDNLR PYDDSSNNMW SLGENSEFHA  120
YSCVEGVVGP SEPIMSAFGE EDFPFLISNK RNDLSLSLAT DVSDECSEIS LCAATKSTRI  180
TSEQASSSSK DISNNVPQVI FGSKYLHSVQ EVLSHFARYS LDGLENNPQC YFSSRETESG  240
APNSAFTSCF ENLTEFLDGG FNNSEAGSGS TSQRRALEAK KTHLLDLLQM VDDRYSNCID  300
EIHTVVSAFH AATELDPQLH TRFALQTISF LYKNLRERIS KKILMMGSVL ERGKEKSQEN  360
SIFHQHCLLQ QLKRKNHQIW RPQRGLPEKS VSVLRTWMFQ NFLHPYPKDS EKHLLAIRSG  420
LTRSQVSNWF INARVRLWKP MIEEMYAEMN KRKLNNTHLQ GNGGSHRMPK SVMMSQERDK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A5e-14386444563Homeobox protein Meis2
3k2a_B5e-14386444563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0965130.0AY096513.1 Arabidopsis thaliana putative homeobox gene ATH1 protein (At4g32980) mRNA, complete cds.
GenBankAY0721740.0AY072174.1 Arabidopsis thaliana putative homeobox gene ATH1 protein (At4g32980) mRNA, complete cds.
GenBankX801260.0X80126.1 A.thaliana AtH1 mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412405.10.0hypothetical protein EUTSA_v10025083mg
SwissprotP487310.0ATH1_ARATH; Homeobox protein ATH1
TrEMBLV4MM230.0V4MM23_EUTSA; Uncharacterized protein
STRINGBra011403.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM82282637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.10.0homeobox gene 1