PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g29840
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family TALE
Protein Properties Length: 385aa    MW: 43238.4 Da    PI: 6.4617
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g29840genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.59.8e-083293622154
                HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                k +yp++e++ +L +++gL+ +q+ +WF N+R +
  Tp7g29840 329 KWPYPTEEDKSKLVQETGLQLKQINNWFINQRKR 362
                569*****************************87 PP

2ELK26.81.2e-09283304122
        ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                ELKh+L+++++ +++++++E++
  Tp7g29840 283 ELKHELKQGFKDKIVDIREEIM 304
                9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012552.7E-18118162IPR005540KNOX1
PfamPF037901.6E-16120161IPR005540KNOX1
SMARTSM012561.9E-24169224IPR005541KNOX2
PfamPF037916.3E-18174223IPR005541KNOX2
PfamPF037895.0E-5283304IPR005539ELK domain
SMARTSM011885.9E-4283304IPR005539ELK domain
PROSITE profilePS512139.446283303IPR005539ELK domain
PROSITE profilePS5007112.034303366IPR001356Homeobox domain
SMARTSM003895.7E-10305370IPR001356Homeobox domain
SuperFamilySSF466892.18E-15305370IPR009057Homeodomain-like
CDDcd000864.31E-11306362No hitNo description
Gene3DG3DSA:1.10.10.607.3E-25310368IPR009057Homeodomain-like
PfamPF059202.1E-17323362IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009727Biological Processdetection of ethylene stimulus
GO:0071369Biological Processcellular response to ethylene stimulus
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MSFNSSHLLP PQEDLPLRHL SDQSQQPPQR HCSETPSLLT ASFLNLPSTA ATADSDFAHP  60
HRNGDTSSAA TNRRWLSFHT EIQNGGDGDP EVIDGVNADG ETTHGVVGVD GGEDWRSASY  120
KAAILRHPMY EQLLAAHVAC LRVATPVDQI PRIDGQLSQL HTVAAKYSTL GVVMDNKELD  180
HFMSHYVVLL CSLKEQLQHH VCVHAMEAIT ACWEIEQSLQ SITGISPSES NGKTMSDDED  240
DNQVESEVNM FDGSLDGSDC MMGFGPLVPT ERERSLMERV KKELKHELKQ GFKDKIVDIR  300
EEIMRKRRAG KLPGDTTSVL KEWWRTHSKW PYPTEEDKSK LVQETGLQLK QINNWFINQR  360
KRNWNSNSST SSTLSKNKRK RTGKS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1359380RKRNWNSNSSTSSTLSKNKRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3525800.0AK352580.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-04-I15.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_194932.10.0homeobox protein knotted-1-like 5
SwissprotP480020.0KNAT5_ARATH; Homeobox protein knotted-1-like 5
TrEMBLD7MAS60.0D7MAS6_ARALL; Putative uncharacterized protein
STRINGAT4G32040.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM44428158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32040.10.0KNOTTED1-like homeobox gene 5