PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g26940
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family CPP
Protein Properties Length: 717aa    MW: 78233.8 Da    PI: 8.8918
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g26940genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.92.2e-14246286142
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                ++kk+CnCk+s+Clk+YCeCfa+g++C+  C+C +C+N+ e+
  Tp7g26940 246 QKKKQCNCKHSRCLKLYCECFASGTYCDG-CNCINCFNNVEN 286
                589**************************.********9875 PP

2TCR50.34.6e-16331369139
        TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN 
  Tp7g26940 331 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCLDCKNF 369
                589***********************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.4E-16246286IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.193247371IPR005172CRC domain
PfamPF036388.0E-11248283IPR005172CRC domain
SMARTSM011144.4E-19331372IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12334369IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 717 aa     Download sequence    Send to blast
MNLSPRRDFN GYRSPPSRGY PRDYPPPRHE HPTWRDRDRE RDRLRYSDLD YPPSRRIASD  60
WVHPELLPKP HYERRPPLCP PPPPLPPPRA GRWGRHLRER SRSPSLRDGP PPLMRGGPPP  120
MGEGGGGGEF PPKKDGVSDE SGFPTKKPAR QLDFTGGSDE HSLSKPAPTV VAAAAKPIVT  180
PSVPSPVTTT TTTSRLHPVI RPTLPVVTPN PPSQSQILNP PIRLPKPESP KSRPRPIVEA  240
RDGTPQKKKQ CNCKHSRCLK LYCECFASGT YCDGCNCINC FNNVENEPAR RDAVEATLER  300
NPNAFRPKIA SSPHSVRDKR EEIGEVVLLG KHNKGCHCKK SGCLKKYCEC FQANILCSEN  360
CKCLDCKNFD GSEERQALFH GEHANNMAYL QQAANAAITG AVGSSGFAPS PAPKRRKGQD  420
IMFNQATKDS STHRLGQFQQ ENNGRTSSPT LGTSPTTFSR AGGNSSVAPS KFVYRSLLAD  480
IIQPQDVKAL CSVLVAVAGE AAKTLTDQRN RTENRVEDQT ETSLASSAQD NSQGNKDAGD  540
VEMVATDGNQ ADKSGTENSN SDGADASKGK PLSPATLALM CDEQDTIFMV AAAEPNGSVD  600
PGGCGPNTQG QSETYAEQER VVLTKFRDCL SRLISYAELK ESKCSYLARR HLQSPPSATV  660
KTENGIQQIP PIVNGPSRTS TQPTLNKPPH LQPMTTTNTS STHHPHKPPA LPEKKDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A4e-3024838011132Protein lin-54 homolog
5fd3_B4e-3024838011132Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13444RDRDRERDRLR
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp7g26940
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006412891.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0D3A3M40.0A0A0D3A3M4_BRAOL; Uncharacterized protein
STRINGBo1g016960.10.0(Brassica oleracea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17832884
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.10.0Tesmin/TSO1-like CXC domain-containing protein