PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g24350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 533aa    MW: 58967.3 Da    PI: 6.355
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g24350genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.81.4e-30180237260
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS-- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhek 60 
                dDgynWrKYGqK vkgse+prsYY+Ct+++C+vkkkvers+ ++ ++eitY  +Hnh+k
  Tp7g24350 180 DDGYNWRKYGQKLVKGSEYPRSYYKCTHPNCEVKKKVERSR-EGYITEITYAKSHNHPK 237
                8****************************************.***************85 PP

2WRKY99.71.9e-31373430259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                +Dgy+WrKYGqK+vkg+++prsYY+Ct +gC v+k+ver+++d + v +tY g+H+he
  Tp7g24350 373 EDGYRWRKYGQKVVKGNPNPRSYYKCTASGCIVTKHVERASDDLTSVLTTYIGKHTHE 430
                8********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.1E-27170238IPR003657WRKY domain
PROSITE profilePS5081123.709174238IPR003657WRKY domain
SuperFamilySSF1182908.5E-25177238IPR003657WRKY domain
SMARTSM007742.7E-32179237IPR003657WRKY domain
PfamPF031066.6E-24180236IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.7E-33357432IPR003657WRKY domain
SuperFamilySSF1182901.7E-27365432IPR003657WRKY domain
PROSITE profilePS5081134.199367432IPR003657WRKY domain
SMARTSM007742.9E-35372431IPR003657WRKY domain
PfamPF031065.1E-24373430IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009409Biological Processresponse to cold
GO:0009555Biological Processpollen development
GO:0009846Biological Processpollen germination
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 533 aa     Download sequence    Send to blast
MAGFYDNFSV MGERLEPSPN HKKRSKAEVD REVSLEDNKN KDFIQTSFQE RPSYSRGSLS  60
ERICARTGFN VPRLDTESIL RTPYLTISSP GVSPATLLES PVFLSNPLPS PTTGKLSSLP  120
SDKVKDEFLD DIGTSLAFQS ISRRSLDPTN IGLEPDGSQD YEQTHDNDLV DSTPTDAHED  180
DGYNWRKYGQ KLVKGSEYPR SYYKCTHPNC EVKKKVERSR EGYITEITYA KSHNHPKPLP  240
NRRSGIGLTG TGLDMQINGT KQEVFAGTNE NIEWTSPVSR DLGCGSHFGS MQVQNGTQFG  300
YGDAATAAFF KDEKEEDRTS HMSISLGYDG EVDESKPKRR KLEAYATEMS GSTGAIRDPK  360
VVVETKSDID ILEDGYRWRK YGQKVVKGNP NPRSYYKCTA SGCIVTKHVE RASDDLTSVL  420
TTYIGKHTHE VPAASNSSHV SLGSSGTLQG SLATQTHNQQ VHYPMPQRRS EGLVTANSSL  480
FDFQPHLRPP GFSVYRGQTE FLDLSMPNLA IGQERLDGLP APAIGDLDGG YCS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-29157433478Probable WRKY transcription factor 4
2lex_A2e-29157433478Probable WRKY transcription factor 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006413182.10.0hypothetical protein EUTSA_v10027010mg
SwissprotO655900.0WRK34_ARATH; Probable WRKY transcription factor 34
TrEMBLV4LVG80.0V4LVG8_EUTSA; Uncharacterized protein
STRINGfgenesh1_pm.C_scaffold_70012650.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM141811524
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G26440.10.0WRKY DNA-binding protein 34