PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g23460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family M-type_MADS
Protein Properties Length: 195aa    MW: 22518 Da    PI: 8.932
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g23460genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.73.1e-28959151
               S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
     SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
               k+ien++ rqvtfskRr+g+lKKA+ELS+LCda+va i+fs++g+ly+++s
  Tp7g23460  9 KKIENETSRQVTFSKRRKGLLKKAHELSILCDAQVATIVFSQKGRLYDFAS 59
               68***********************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.3161IPR002100Transcription factor, MADS-box
SuperFamilySSF554553.66E-30371IPR002100Transcription factor, MADS-box
CDDcd002651.12E-39370No hitNo description
PRINTSPR004041.5E-29323IPR002100Transcription factor, MADS-box
PfamPF003192.4E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-292338IPR002100Transcription factor, MADS-box
PRINTSPR004041.5E-293859IPR002100Transcription factor, MADS-box
PROSITE profilePS512976.6862156IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MVRGKIEIKK IENETSRQVT FSKRRKGLLK KAHELSILCD AQVATIVFSQ KGRLYDFASS  60
DMQKMMERWE IYRREYSGAE RLQKQQHVQE LKNQMAIMVN KIELLQLHCS LTIVRSRKAK  120
LTEDKIENLK AQIEGEREVL NEGSRLRQMF GEEPLWMQSR SLESEESAPS CGCGNMNISD  180
VVETGLSIGL PERQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_A7e-20372271Myocyte-specific enhancer factor 2A
3mu6_B7e-20372271Myocyte-specific enhancer factor 2A
3mu6_C7e-20372271Myocyte-specific enhancer factor 2A
3mu6_D7e-20372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtMADS-box transcription factor that acts with AGL42 and AGL71 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1. {ECO:0000269|PubMed:21609362}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp7g23460
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1893099e-61AC189309.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB034C07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109211.11e-105PREDICTED: MADS-box protein AGL71-like
RefseqXP_009109212.11e-105PREDICTED: MADS-box protein AGL71-like
RefseqXP_013656515.11e-105MADS-box protein AGL71
RefseqXP_018509436.11e-105PREDICTED: MADS-box protein AGL71-like
SwissprotQ9FLH51e-52AGL72_ARATH; MADS-box protein AGL72
TrEMBLA0A078ISC41e-104A0A078ISC4_BRANA; BnaA08g30890D protein
STRINGXP_006413306.11e-104(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88051235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G51860.24e-58MIKC_MADS family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]