PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g15950
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family WRKY
Protein Properties Length: 311aa    MW: 34680.9 Da    PI: 8.0297
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g15950genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY108.14.3e-34165222259
                --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
       WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                +Dgy+WrKYGqK vk+s++prsYYrCt+++C+vkk+vers +dp+vv++tYeg+Hnh+
  Tp7g15950 165 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQRCNVKKRVERSFQDPTVVITTYEGQHNHP 222
                8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0381301.3E-1091311IPR017396PWRKY transcription factor, group IIc
Gene3DG3DSA:2.20.25.801.2E-35149224IPR003657WRKY domain
SuperFamilySSF1182901.2E-29156224IPR003657WRKY domain
PROSITE profilePS5081132.856159224IPR003657WRKY domain
SMARTSM007741.8E-39164223IPR003657WRKY domain
PfamPF031062.3E-26165222IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 311 aa     Download sequence    Send to blast
MSNETKDLYN YQYPSSFSLY EMMNLPTSTP SSYGNNVFDP SSYSFVDCLQ SSPGAYNSLL  60
QKTFGLSPSS SEVFNSSTDQ ESKRDVTNDG TGETPTRVSA SSSSSEADHP SEDSGKSQRK  120
RELAGDGGEE NQSSKKVGKT KKKEEKKQRE PRVSFMTKSE VDHLEDGYRW RKYGQKAVKN  180
SPYPRSYYRC TTQRCNVKKR VERSFQDPTV VITTYEGQHN HPIPTNLRGS SAAAAMYSAD  240
FMTPRSLAHD MFRTAAYTSG GSAAAALDYG YGQSGYGSVN ANPNSHQEYR QGGEYELLKE  300
IFPSIFFKQE P
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A1e-29155224877Probable WRKY transcription factor 4
2lex_A1e-29155224877Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00440DAPTransfer from AT4G18170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF4300450.0KF430045.1 Brassica rapa WRKY transcription factor 28 (WRKY28) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013595930.10.0PREDICTED: probable WRKY transcription factor 28
SwissprotQ8VWJ20.0WRK28_ARATH; Probable WRKY transcription factor 28
TrEMBLA0A0D3DET20.0A0A0D3DET2_BRAOL; Uncharacterized protein
STRINGBra012614.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15242693
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18170.11e-159WRKY DNA-binding protein 28