PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g11190
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GeBP
Protein Properties Length: 327aa    MW: 36785.7 Da    PI: 8.3765
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g11190genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573113.61.2e-35104197298
     DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                 f+rlwse+Dei+lLqG+idfka+tgksps+d+d+fye  +k isf++s+sq+veKir+LKkK+ kkv+    g e sf k hd++ ++l+k iWg+
  Tp7g11190 104 SFRRLWSEKDEISLLQGMIDFKADTGKSPSEDMDGFYELTRKLISFEASRSQFVEKIRSLKKKYMKKVNL--WGVE-SFCKGHDKERLKLAKYIWGT 197
                699*****************************************************************99..5555.9*****************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.5E-26105196IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MAKKKLNPLE DPPTASSSDE EEEVEEQISD DSSSEEEEEE LNNPVKTPSA AATSAKPKVR  60
HLPAVKLGKK RQSEKTSKEV NAKRAKKGSE DIEKKIVDDT KKPSFRRLWS EKDEISLLQG  120
MIDFKADTGK SPSEDMDGFY ELTRKLISFE ASRSQFVEKI RSLKKKYMKK VNLWGVESFC  180
KGHDKERLKL AKYIWGTDEM ALGSAVKSNV KKSEKKLDSL KPHAKEVEEV VSDGMTLENV  240
VKSNGTSKKS DQKLNSSEAN GEKVEEDKEV LAHGRDLKSL GVMSASDWFE DSFLVGSIAS  300
LGVSEKFVKQ KWSMVAVESK KRMEEKW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013723127.12e-92PREDICTED: mediator-associated protein 1-like
RefseqXP_013631638.12e-92PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0D3DLL21e-99A0A0D3DLL2_BRAOL; Uncharacterized protein
STRINGBra032717.1-P1e-84(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.17e-57DNA-binding storekeeper protein-related transcriptional regulator