PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g11180
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GeBP
Protein Properties Length: 627aa    MW: 70376.8 Da    PI: 6.0307
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g11180genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573125.32.7e-39246338298
     DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWgs 98 
                lfqrlwseeDei+lLqG+idfka+tg sp++d+d+fy f +ksisf++sk+q+++Kir+LKkK+ +kvk+   g e sf k+hd ++f+lsk iWgs
  Tp7g11180 246 LFQRLWSEEDEISLLQGMIDFKADTGDSPYEDMDRFYGFTRKSISFDASKNQFMDKIRSLKKKYMGKVKN---GLE-SFPKAHDMECFKLSKYIWGS 338
                69*******************************************************************9...666.9*****************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045043.3E-31247337IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 627 aa     Download sequence    Send to blast
MGETYKKDLA RQILDDMANN HLTHYGTTIG HQSQLLVRLW NYTVFLLITF ISKKKHFCLY  60
ILFAGRFSST CPLQTLKAKA FTSNSALTLF LLHYKKNSFM AKKLNPLEDP PTASSSEEDE  120
VEILSEEEEE EVEEQISDDS SSEEEDDLMN PVVVPPVTKP KSSSSAAATI ALPGKYAVAS  180
GSNSSPSKPG SKKPKENVVC GSPAVKSGKK RPSEKTISTE VNAKRSKKVS EDNEMKVVED  240
TKKPLLFQRL WSEEDEISLL QGMIDFKADT GDSPYEDMDR FYGFTRKSIS FDASKNQFMD  300
KIRSLKKKYM GKVKNGLESF PKAHDMECFK LSKYIWGSHE MALKSDVKSN VKKSEKKLDS  360
VKPHGKKVKE IESDGVPVKS AVKSNGTPKK SKEKLDSLKA NGEKVEEDHR EVLVSGKNVE  420
EGKEVLINDE KVEEDREVLV NGEKVDEDKE VLVNGEKLEE DREVLVGEKV EEDKEVLVNG  480
GDWKSLGVMI ASDWFEDSFL VGSIASLGVS EKFVKQKWSM VAVETKKRME EKWKLLQAKE  540
MELVLQKTDF MPNIKNSRSV FNRHWTGDKS TDIDSPMQTL DETSIPTGET STLQENGIPK  600
TSTCRRHVTQ PLVPHFDLLV GQSTTAS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013723127.11e-133PREDICTED: mediator-associated protein 1-like
TrEMBLA0A0D3BYZ31e-132A0A0D3BYZ3_BRAOL; Uncharacterized protein
STRINGBra032717.1-P1e-109(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.11e-47DNA-binding storekeeper protein-related transcriptional regulator