PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g05700
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family GeBP
Protein Properties Length: 303aa    MW: 34559.5 Da    PI: 9.1558
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g05700genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF573114.94.9e-36106199297
     DUF573   2 lfqrlwseeDeivlLqGlidfkaktgkspsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97 
                +f+rl+se+Dei +LqG+idfk++t+k p++d +++yefvk+sisf+vs +q++eKi+ LK+Kf +k +k  +gk ++f+++hd+kifelsk+iWg
  Tp7g05700 106 KFRRLFSEQDEIFVLQGIIDFKTETEKTPVQDKNGIYEFVKGSISFEVSIDQFMEKIKTLKRKFLGKIEK--KGKGKAFANAHDEKIFELSKIIWG 199
                79********************************************************************..99999******************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045044.9E-28107199IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MAKKKQAKPV QQPPSDDEEV EISEEEDERV KASSGKKLKP PSCAATISTK QASTVVAVVA  60
AKKKKKKARG SGEAQTSTAL ASPTMKNKRP SEETYSAGKE EEEKPKFRRL FSEQDEIFVL  120
QGIIDFKTET EKTPVQDKNG IYEFVKGSIS FEVSIDQFME KIKTLKRKFL GKIEKKGKGK  180
AFANAHDEKI FELSKIIWGC EVESVAASVK SRKSERSTKR KLEEVEEKDV SSILGEDWFN  240
KSYLVGLIAS FGMEEDYVKQ RWTLSPMEEK KKIEEQWKYL YLQEMRFVLS KLEFEYELAS  300
CQS
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31328181
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61730.11e-50DNA-binding storekeeper protein-related transcriptional regulator