PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Tp7g00880
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassicaceae incertae sedis; Schrenkiella
Family TCP
Protein Properties Length: 256aa    MW: 28476.6 Da    PI: 9.0011
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Tp7g00880genomethellungiellaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP100.62.8e-3161138381
        TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssss 81 
                 +k++ +++h kv gR+RRvRl+ +caar+F+L++eLG+++d++t++WLl  a+p+i+ +tg++ ++ s+  a +s+s+
  Tp7g00880  61 IQKKSYKDRHLKVQGRGRRVRLPPLCAARIFQLTRELGHKSDGETLQWLLHHAEPSIISATGSGIKPTSAE-ATDSVSQ 138
                6899***********************************************************77777322.3333333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.5E-2565226IPR005333Transcription factor, TCP
PROSITE profilePS5136923.41666120IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 256 aa     Download sequence    Send to blast
MDPKNPNLQN FLNPSPENQD NNEKKKTTKE TEAKVLNTVD GKRKQKQKQK QKEKDEEQHQ  60
IQKKSYKDRH LKVQGRGRRV RLPPLCAARI FQLTRELGHK SDGETLQWLL HHAEPSIISA  120
TGSGIKPTSA EATDSVSQPP LAADLNLEIA SRSQLSNGFW TNETGFGGGA NAATTGGFDL  180
NYGIGFLGFD FNGSSEMGFE NNQMPKVGLG LSQVGVLNPQ IYQQMGQEQT KVLLHHHHHH  240
HHPHEAQQEN ADKNGS
Cis-element ? help Back to Top
SourceLink
PlantRegMapTp7g00880
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006405404.11e-116transcription factor TCP6
SwissprotQ9FLM61e-88TCP6_ARATH; Transcription factor TCP6
TrEMBLV4LWE91e-115V4LWE9_EUTSA; Uncharacterized protein
STRINGXP_006405404.11e-116(Eutrema salsugineum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM157431416
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41030.13e-73TCP family protein
Publications ? help Back to Top
  1. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]